PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G49950.1
Common NameF3A4.30, SCL32
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family GRAS
Protein Properties Length: 410aa    MW: 46355.1 Da    PI: 6.019
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G49950.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS343.92.7e-105284072373
         GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaN 99 
                  ++lLl+cA+a++s+d++l++++L+ l+++a pdgd++qRl++ f++AL +r ++++++l+++++  +++++ +  ++  l +f++++P+++f++++aN
  AT3G49950.1  28 EQLLLHCATAIDSNDAALTHQILWVLNNIAPPDGDSTQRLTSAFLRALLSRAVSKTPTLSSTISFLPQADELHRFSVVELAAFVDLTPWHRFGFIAAN 125
                  79******************************************************************97666666666677**************** PP

         GRAS 100 qaIleavegeervHiiDfdisqGlQWpaLlqaLasRp.egppslRiTgvgspesg...skeeleetgerLakfAeelgvpfefnvl...vakrledle 190
                   aIl aveg ++vHi+D+++++++Q p+L++a+asR  ++pp l++T+v+s++++    + ++ee+g++L +fA++ ++++ef+++   +++ +++l 
  AT3G49950.1 126 AAILTAVEGYSTVHIVDLSLTHCMQIPTLIDAMASRLnKPPPLLKLTVVSSSDHFppfINISYEELGSKLVNFATTRNITMEFTIVpstYSDGFSSL- 222
                  ************************************966777*********99889999**************************988666777777. PP

         GRAS 191 leeLrvkp...gEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseeri 283
                  l++Lr+ p   +Eal+Vn++++l ++++e+++++s   r+ +Lk+++sl+P++v+++e+++d++se++++r+ +a++y++  fd++++ +   se+r+
  AT3G49950.1 223 LQQLRIYPssfNEALVVNCHMMLRYIPEEPLTSSSssLRTVFLKQLRSLNPRIVTLIEEDVDLTSENLVNRLKSAFNYFWIPFDTTDTFM---SEQRR 317
                  9****************************9988877799**************************************************7...9**** PP

         GRAS 284 kvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaW 373
                  ++E+e ++++i+nvva+egaer+er+et+++W er++ea F+ v+++e+a++++k++l++++ ++g++ e++++slvl+Wk++++v++++W
  AT3G49950.1 318 WYEAE-ISWKIENVVAKEGAERVERTETKRRWIERMREAEFGGVRVKEDAVADVKAMLEEHAvGWGMKKEDDDESLVLTWKGHSVVFATVW 407
                  *****.************************************************************************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098545.6821387IPR005202Transcription factor GRAS
PfamPF035149.4E-10328407IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000037anatomyshoot apex
Sequence ? help Back to Top
Protein Sequence    Length: 410 aa     Download sequence    Send to blast
MTKTRILNPT RFPSPKPLRG CGDANFMEQL LLHCATAIDS NDAALTHQIL WVLNNIAPPD  60
GDSTQRLTSA FLRALLSRAV SKTPTLSSTI SFLPQADELH RFSVVELAAF VDLTPWHRFG  120
FIAANAAILT AVEGYSTVHI VDLSLTHCMQ IPTLIDAMAS RLNKPPPLLK LTVVSSSDHF  180
PPFINISYEE LGSKLVNFAT TRNITMEFTI VPSTYSDGFS SLLQQLRIYP SSFNEALVVN  240
CHMMLRYIPE EPLTSSSSSL RTVFLKQLRS LNPRIVTLIE EDVDLTSENL VNRLKSAFNY  300
FWIPFDTTDT FMSEQRRWYE AEISWKIENV VAKEGAERVE RTETKRRWIE RMREAEFGGV  360
RVKEDAVADV KAMLEEHAVG WGMKKEDDDE SLVLTWKGHS VVFATVWVPI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-20293486314GRAS family transcription factor containing p
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible252237_at0.0
Expression AtlasAT3G49950-
AtGenExpressAT3G49950-
ATTED-IIAT3G49950-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in seedlings, leaves and flowers. {ECO:0000269|PubMed:18500650}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G49950.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G49950
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0026860.0CP002686.1 Arabidopsis thaliana chromosome 3, complete sequence.
GenBankBT0125530.0BT012553.1 Arabidopsis thaliana At3g49950 gene, complete cds.
GenBankAL1329780.0AL132978.1 Arabidopsis thaliana DNA chromosome 3, BAC clone F3A4.
GenBankAK2266230.0AK226623.1 Arabidopsis thaliana mRNA for hypothetical protein, complete cds, clone: RAFL07-29-K13.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_190564.10.0scarecrow-like protein 32
SwissprotQ9SN220.0SCL32_ARATH; Scarecrow-like protein 32
TrEMBLR0FNR70.0R0FNR7_9BRAS; Uncharacterized protein
STRINGAT3G49950.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP24991534
MalvidsOGEM54452750
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Jiao Y, et al.
    A genome-wide analysis of blue-light regulation of Arabidopsis transcription factor gene expression during seedling development.
    Plant Physiol., 2003. 133(4): p. 1480-93
    [PMID:14605227]
  3. Bolle C
    The role of GRAS proteins in plant signal transduction and development.
    Planta, 2004. 218(5): p. 683-92
    [PMID:14760535]
  4. Tian C,Wan P,Sun S,Li J,Chen M
    Genome-wide analysis of the GRAS gene family in rice and Arabidopsis.
    Plant Mol. Biol., 2004. 54(4): p. 519-32
    [PMID:15316287]
  5. Gao MJ,Parkin I,Lydiate D,Hannoufa A
    An auxin-responsive SCARECROW-like transcriptional activator interacts with histone deacetylase.
    Plant Mol. Biol., 2004. 55(3): p. 417-31
    [PMID:15604690]
  6. Lifschitz E, et al.
    The tomato FT ortholog triggers systemic signals that regulate growth and flowering and substitute for diverse environmental stimuli.
    Proc. Natl. Acad. Sci. U.S.A., 2006. 103(16): p. 6398-403
    [PMID:16606827]
  7. Wang JW,Schwab R,Czech B,Mica E,Weigel D
    Dual effects of miR156-targeted SPL genes and CYP78A5/KLUH on plastochron length and organ size in Arabidopsis thaliana.
    Plant Cell, 2008. 20(5): p. 1231-43
    [PMID:18492871]
  8. Lee MH, et al.
    Large-scale analysis of the GRAS gene family in Arabidopsis thaliana.
    Plant Mol. Biol., 2008. 67(6): p. 659-70
    [PMID:18500650]
  9. Efroni I,Blum E,Goldshmidt A,Eshed Y
    A protracted and dynamic maturation schedule underlies Arabidopsis leaf development.
    Plant Cell, 2008. 20(9): p. 2293-306
    [PMID:18805992]