PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G49530.1
Common NameANAC062, NAC062, NTL6, T9C5.120
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 469aa    MW: 52493.9 Da    PI: 5.9401
Description NAC domain containing protein 62
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G49530.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM159.61.2e-49131411128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96 
                  lp+G+rF+Ptdeel+ +yL++k++g++ ++ ++i+e+di+k+ePwdLp  + +k++++ew +F++ d+ky++g+r+nrat +gyWkatgkd++++s k
  AT3G49530.1  13 LPVGLRFRPTDEELIRYYLRRKINGHDDDV-KAIREIDICKWEPWDLPdfSVIKTKDSEWLYFCPLDRKYPSGSRQNRATVAGYWKATGKDRKIKSGK 109
                  799************************999.89***************6448889999**************************************99 PP

          NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                  ++ +g+k+tLvf+ grap+g++t+W++heyr+
  AT3G49530.1 110 TNIIGVKRTLVFHAGRAPRGTRTNWIIHEYRA 141
                  99****************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019419.42E-566164IPR003441NAC domain
PROSITE profilePS5100553.82313164IPR003441NAC domain
PfamPF023651.9E-2314140IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007275Biological Processmulticellular organism development
GO:0009814Biological Processdefense response, incompatible interaction
GO:0010200Biological Processresponse to chitin
GO:0070417Biological Processcellular response to cold
GO:0005634Cellular Componentnucleus
GO:0005886Cellular Componentplasma membrane
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025195anatomypollen tube cell
PO:0025281anatomypollen
PO:0001017developmental stageM germinated pollen stage
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 469 aa     Download sequence    Send to blast
MNQNLHVLSM DSLPVGLRFR PTDEELIRYY LRRKINGHDD DVKAIREIDI CKWEPWDLPD  60
FSVIKTKDSE WLYFCPLDRK YPSGSRQNRA TVAGYWKATG KDRKIKSGKT NIIGVKRTLV  120
FHAGRAPRGT RTNWIIHEYR ATEDDLSGTN PGQSPFVICK LFKKEELVLG EEDSKSDEVE  180
EPAVSSPTVE VTKSEVSEVI KTEDVKRHDI AESSLVISGD SHSDACDEAT TAELVDFKWY  240
PELESLDFTL FSPLHSQVQS ELGSSYNTFQ PGSSNFSGNN NNSFQIQTQY GTNEVDTYIS  300
DFLDSILKSP DEDPEKHKYV LQSGFDVVAP DQIAQVCQQG SAVDMSNDVS VTGIQIKSRQ  360
AQPSGYTNDY IAQGNGPRRL RLQSNFNGIN TKNPELQAIK REAEDTVGES IKKRCGKLMR  420
SKNVTGFVFK KITSVKCSYG GLFRAAVVAV VFLMSVCSLT VDFRASAVS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-4531657166NO APICAL MERISTEM PROTEIN
1ut4_B3e-4531657166NO APICAL MERISTEM PROTEIN
1ut7_A3e-4531657166NO APICAL MERISTEM PROTEIN
1ut7_B3e-4531657166NO APICAL MERISTEM PROTEIN
3swm_A4e-45316510169NAC domain-containing protein 19
3swm_B4e-45316510169NAC domain-containing protein 19
3swm_C4e-45316510169NAC domain-containing protein 19
3swm_D4e-45316510169NAC domain-containing protein 19
3swp_A4e-45316510169NAC domain-containing protein 19
3swp_B4e-45316510169NAC domain-containing protein 19
3swp_C4e-45316510169NAC domain-containing protein 19
3swp_D4e-45316510169NAC domain-containing protein 19
4dul_A3e-4531657166NAC domain-containing protein 19
4dul_B3e-4531657166NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.10320.0flower| leaf| root| seed
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible252278_at0.0
Expression AtlasAT3G49530-
AtGenExpressAT3G49530-
ATTED-IIAT3G49530-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, rosette leaves, cauline leaves and stems. {ECO:0000269|PubMed:17158162}.
Functional Description ? help Back to Top
Source Description
TAIRTranscription factor that serves as a molecular link between cold signals and pathogen resistance responses. Undergoes proteolytic processing triggered by cold-induced changes in membrane fluidity.
UniProtTranscriptional activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP) (PubMed:20156199, PubMed:19947982). Transcriptional activator involved in response to cold stress. Mediates induction of pathogenesis-related (PR) genes independently of salicylic signaling in response to cold. Binds directly to the PR gene promoters and enhances plant resistance to pathogen infection, incorporating cold signals into pathogen resistance responses (PubMed:19947982). Plays a regulatory role in abscisic acid (ABA)-mediated drought-resistance response (PubMed:22967043). {ECO:0000269|PubMed:19947982, ECO:0000269|PubMed:20156199, ECO:0000269|PubMed:22967043}.
Function -- GeneRIF ? help Back to Top
  1. NTL6 activation is triggered by exposure to cold, and the transcriptionally active form of NTL6 induces the expression of PR genes by directly binding to the gene promoters and enhances plant resistance to pathogen infection.
    [PMID: 19947982]
  2. NTL6 plays an integrative role in plant responses to both biotic and abiotic stress conditions.
    [PMID: 20139739]
  3. The observations indicate that a metalloprotease activity is responsible for NTL6 processing in response to cold-induced changes in membrane fluidity.
    [PMID: 20156199]
  4. Transgenic plants overproducing either NTL6 or its active form 6deltaC exhibit enhanced resistance to water-deficit conditions.
    [PMID: 22967043]
  5. the membrane-associated transcription factor NAC062 relays endoplasmic reticulum (ER) stress signaling from the plasma membrane to the nucleus and plays important roles in regulating unfolded protein response (UPR)downstream gene expression.
    [PMID: 24961665]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00398DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G49530.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By salt, drought stress, abscisic acid (ABA), salicylic acid (SA) and methyl methanesulfonate (MMS) treatment. {ECO:0000269|PubMed:17158162}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDsalicylic acid
Interaction ? help Back to Top
Source Intact With
IntActSearch Q9SCK6
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G49530
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0597340.0AY059734.1 Arabidopsis thaliana putative NAC2 protein (At3g49530) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_190522.10.0transcription factor NTL6
SwissprotQ9SCK60.0NAC62_ARATH; NAC domain-containing protein 62
TrEMBLD7LSJ80.0D7LSJ8_ARALL; ANAC062
STRINGAT3G49530.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9409612
MalvidsOGEM24162873
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  3. Ooka H, et al.
    Comprehensive analysis of NAC family genes in Oryza sativa and Arabidopsis thaliana.
    DNA Res., 2003. 10(6): p. 239-47
    [PMID:15029955]
  4. Ko JH,Han KH,Park S,Yang J
    Plant body weight-induced secondary growth in Arabidopsis and its transcription phenotype revealed by whole-transcriptome profiling.
    Plant Physiol., 2004. 135(2): p. 1069-83
    [PMID:15194820]
  5. Millenaar FF, et al.
    How to decide? Different methods of calculating gene expression from short oligonucleotide array data will give different results.
    BMC Bioinformatics, 2006. 7: p. 137
    [PMID:16539732]
  6. Nakano T, et al.
    Identification of genes of the plant-specific transcription-factor families cooperatively regulated by ethylene and jasmonate in Arabidopsis thaliana.
    J. Plant Res., 2006. 119(4): p. 407-13
    [PMID:16820983]
  7. Kim SY, et al.
    Exploring membrane-associated NAC transcription factors in Arabidopsis: implications for membrane biology in genome regulation.
    Nucleic Acids Res., 2007. 35(1): p. 203-13
    [PMID:17158162]
  8. Ma S,Bohnert HJ
    Integration of Arabidopsis thaliana stress-related transcript profiles, promoter structures, and cell-specific expression.
    Genome Biol., 2007. 8(4): p. R49
    [PMID:17408486]
  9. Kim SG,Kim SY,Park CM
    A membrane-associated NAC transcription factor regulates salt-responsive flowering via FLOWERING LOCUS T in Arabidopsis.
    Planta, 2007. 226(3): p. 647-54
    [PMID:17410378]
  10. Libault M,Wan J,Czechowski T,Udvardi M,Stacey G
    Identification of 118 Arabidopsis transcription factor and 30 ubiquitin-ligase genes responding to chitin, a plant-defense elicitor.
    Mol. Plant Microbe Interact., 2007. 20(8): p. 900-11
    [PMID:17722694]
  11. Chawade A,Br
    Putative cold acclimation pathways in Arabidopsis thaliana identified by a combined analysis of mRNA co-expression patterns, promoter motifs and transcription factors.
    BMC Genomics, 2007. 8: p. 304
    [PMID:17764576]
  12. Ascencio-Ib
    Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection.
    Plant Physiol., 2008. 148(1): p. 436-54
    [PMID:18650403]
  13. Wang Y, et al.
    Transcriptome analyses show changes in gene expression to accompany pollen germination and tube growth in Arabidopsis.
    Plant Physiol., 2008. 148(3): p. 1201-11
    [PMID:18775970]
  14. Seo PJ, et al.
    Cold activation of a plasma membrane-tethered NAC transcription factor induces a pathogen resistance response in Arabidopsis.
    Plant J., 2010. 61(4): p. 661-71
    [PMID:19947982]
  15. Abdeen A,Schnell J,Miki B
    Transcriptome analysis reveals absence of unintended effects in drought-tolerant transgenic plants overexpressing the transcription factor ABF3.
    BMC Genomics, 2010. 11: p. 69
    [PMID:20105335]
  16. Seo PJ,Park CM
    A membrane-bound NAC transcription factor as an integrator of biotic and abiotic stress signals.
    Plant Signal Behav, 2010. 5(5): p. 481-3
    [PMID:20139739]
  17. Seo PJ, et al.
    Proteolytic processing of an Arabidopsis membrane-bound NAC transcription factor is triggered by cold-induced changes in membrane fluidity.
    Biochem. J., 2010. 427(3): p. 359-67
    [PMID:20156199]
  18. Arabidopsis Interactome Mapping Consortium
    Evidence for network evolution in an Arabidopsis interactome map.
    Science, 2011. 333(6042): p. 601-7
    [PMID:21798944]
  19. Kim MJ, et al.
    Controlled nuclear import of the transcription factor NTL6 reveals a cytoplasmic role of SnRK2.8 in the drought-stress response.
    Biochem. J., 2012. 448(3): p. 353-63
    [PMID:22967043]
  20. Yang ZT, et al.
    A plasma membrane-tethered transcription factor, NAC062/ANAC062/NTL6, mediates the unfolded protein response in Arabidopsis.
    Plant J., 2014. 79(6): p. 1033-43
    [PMID:24961665]
  21. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]