PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G47600.1
Common NameATMYB94, ATMYBCP70, F1P2.150, MYB94
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 333aa    MW: 37143.5 Da    PI: 6.7861
Description myb domain protein 94
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G47600.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.71.3e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +lv +++++G+g+W++++ + g++R+ k+c++rw +yl
      AT3G47600.1 14 KGPWTPEEDIILVSYIQEHGPGNWRSVPTHTGLRRCSKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding48.52.1e-1567112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T+ E++ ++++ ++lG++ W++Ia++++  Rt++++k++w+++l
      AT3G47600.1  67 RGNFTEHEEKMILHLQALLGNR-WAAIASYLP-ERTDNDIKNYWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.6E-25564IPR009057Homeodomain-like
PROSITE profilePS5129426.71965IPR017930Myb domain
SuperFamilySSF466896.11E-3111108IPR009057Homeodomain-like
SMARTSM007172.7E-151363IPR001005SANT/Myb domain
PfamPF002493.4E-171461IPR001005SANT/Myb domain
CDDcd001675.26E-121661No hitNo description
Gene3DG3DSA:1.10.10.601.6E-2465117IPR009057Homeodomain-like
PROSITE profilePS5129419.31866116IPR017930Myb domain
SMARTSM007176.8E-1666114IPR001005SANT/Myb domain
PfamPF002495.2E-1467112IPR001005SANT/Myb domain
CDDcd001671.48E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0030154Biological Processcell differentiation
GO:0046686Biological Processresponse to cadmium ion
GO:0080167Biological Processresponse to karrikin
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 333 aa     Download sequence    Send to blast
MGRPPCCDKI GVKKGPWTPE EDIILVSYIQ EHGPGNWRSV PTHTGLRRCS KSCRLRWTNY  60
LRPGIKRGNF TEHEEKMILH LQALLGNRWA AIASYLPERT DNDIKNYWNT HLKKKLKKMN  120
DSCDSTINNG LDNKDFSISN KNTTSHQSSN SSKGQWERRL QTDINMAKQA LCDALSIDKP  180
QNPTNFSIPD LGYGPSSSSS STTTTTTTTR NTNPYPSGVY ASSAENIARL LQNFMKDTPK  240
TSVPLPVAAT EMAITTAASS PSTTEGDGEG IDHSLFSFNS IDEAEEKPKL IDHDINGLIT  300
QGSLSLFEKW LFDEQSHDMI INNMSLEGQE VLF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A7e-27141164105MYB PROTO-ONCOGENE PROTEIN
1h8a_C8e-271411627128MYB TRANSFORMING PROTEIN
1mse_C6e-27141164105C-Myb DNA-Binding Domain
1msf_C6e-27141164105C-Myb DNA-Binding Domain
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.215910.0flower| seed| silique
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO39415270.0
Genevisible252408_at0.0
Expression AtlasAT3G47600-
AtGenExpressAT3G47600-
ATTED-IIAT3G47600-
Functional Description ? help Back to Top
Source Description
TAIREncodes a putative transcription factor (MYB94).
Function -- GeneRIF ? help Back to Top
  1. R2R3-type MYB94 transcription factor activates Arabidopsis cuticular wax biosynthesis and might be important in plant response to environmental stress, including drought.
    [PMID: 25305760]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00395DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G47600.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDabscisic acid, auxin, ethylene, jasmonic acid, salicylic acid
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G47600
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0043610.0BT004361.1 Arabidopsis thaliana clone U20190 putative transcription factor MYB94 (At3g47600) mRNA, complete cds.
GenBankBT0028020.0BT002802.1 Arabidopsis thaliana clone RAFL15-01-L01 (R20190) putative transcription factor MYB94 (At3g47600) mRNA, complete cds.
GenBankAY5195950.0AY519595.1 Arabidopsis thaliana MYB transcription factor (At3g47600) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_190344.10.0putative transcription factor MYB94
SwissprotP813921e-113MYB06_ANTMA; Myb-related protein 306
TrEMBLQ9SN780.0Q9SN78_ARATH; MYB transcription factor
STRINGAT3G47600.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
MalvidsOGEM4282646
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  3. Nikiforova V, et al.
    Transcriptome analysis of sulfur depletion in Arabidopsis thaliana: interlacing of biosynthetic pathways provides response specificity.
    Plant J., 2003. 33(4): p. 633-50
    [PMID:12609038]
  4. Kersten B, et al.
    Generation of Arabidopsis protein chips for antibody and serum screening.
    Plant Mol. Biol., 2003. 52(5): p. 999-1010
    [PMID:14558660]
  5. Vergnolle C, et al.
    The cold-induced early activation of phospholipase C and D pathways determines the response of two distinct clusters of genes in Arabidopsis cell suspensions.
    Plant Physiol., 2005. 139(3): p. 1217-33
    [PMID:16258011]
  6. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  7. Mandaokar A, et al.
    Transcriptional regulators of stamen development in Arabidopsis identified by transcriptional profiling.
    Plant J., 2006. 46(6): p. 984-1008
    [PMID:16805732]
  8. Soitamo AJ,Piippo M,Allahverdiyeva Y,Battchikova N,Aro EM
    Light has a specific role in modulating Arabidopsis gene expression at low temperature.
    BMC Plant Biol., 2008. 8: p. 13
    [PMID:18230142]
  9. Agudelo-Romero P, et al.
    Changes in the gene expression profile of Arabidopsis thaliana after infection with Tobacco etch virus.
    Virol. J., 2008. 5: p. 92
    [PMID:18684336]
  10. Nelson DC, et al.
    Karrikins enhance light responses during germination and seedling development in Arabidopsis thaliana.
    Proc. Natl. Acad. Sci. U.S.A., 2010. 107(15): p. 7095-100
    [PMID:20351290]
  11. Arabidopsis Interactome Mapping Consortium
    Evidence for network evolution in an Arabidopsis interactome map.
    Science, 2011. 333(6042): p. 601-7
    [PMID:21798944]
  12. Lee SB,Suh MC
    Cuticular wax biosynthesis is up-regulated by the MYB94 transcription factor in Arabidopsis.
    Plant Cell Physiol., 2015. 56(1): p. 48-60
    [PMID:25305760]
  13. Kranz HD, et al.
    Towards functional characterisation of the members of the R2R3-MYB gene family from Arabidopsis thaliana.
    Plant J., 1998. 16(2): p. 263-76
    [PMID:9839469]