PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G47500.1
Common NameCDF3, DOF3.3, F1P2.50, HPPBF-2A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family Dof
Protein Properties Length: 448aa    MW: 49730.3 Da    PI: 7.0586
Description cycling DOF factor 3
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G47500.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.71.4e-39106166262
       zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                  ++k+l+cprC+s++tkfCyynny+++qPr+fCkaC+ryWt+GG++rnvPvG+grrknk+ss
  AT3G47500.1 106 PTKILPCPRCKSMETKFCYYNNYNINQPRHFCKACQRYWTAGGTMRNVPVGAGRRKNKSSS 166
                  67899*****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-31103163IPR003851Zinc finger, Dof-type
PfamPF027017.4E-32108164IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.556110164IPR003851Zinc finger, Dof-type
PROSITE patternPS013610112148IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009908Biological Processflower development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
GO:0046872Molecular Functionmetal ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000084anatomyplant sperm cell
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025195anatomypollen tube cell
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 448 aa     Download sequence    Send to blast
MMMETRDPAI KLFGMKIPFP SVFESAVTVE DDEEDDWSGG DDKSPEKVTP ELSDKNNNNC  60
NDNSFNNSKP ETLDKEEATS TDQIESSDTP EDNQQTTPDG KTLKKPTKIL PCPRCKSMET  120
KFCYYNNYNI NQPRHFCKAC QRYWTAGGTM RNVPVGAGRR KNKSSSSHYR HITISEALEA  180
ARLDPGLQAN TRVLSFGLEA QQQHVAAPMT PVMKLQEDQK VSNGARNRFH GLADQRLVAR  240
VENGDDCSSG SSVTTSNNHS VDESRAQSGS VVEAQMNNNN NNNMNGYACI PGVPWPYTWN  300
PAMPPPGFYP PPGYPMPFYP YWTIPMLPPH QSSSPISQKC SNTNSPTLGK HPRDEGSSKK  360
DNETERKQKA GCVLVPKTLR IDDPNEAAKS SIWTTLGIKN EAMCKAGGMF KGFDHKTKMY  420
NNDKAENSPV LSANPAALSR SHNFHEQI
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.5190.0silique
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1865107500.0
Genevisible252429_at0.0
Expression AtlasAT3G47500-
AtGenExpressAT3G47500-
ATTED-IIAT3G47500-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in the vasculature of cotyledons and hypocotyls, leaves and roots. {ECO:0000269|PubMed:19619493}.
Functional Description ? help Back to Top
Source Description
TAIRDof-type zinc finger domain-containing protein, identical to H-protein promoter binding factor-2a GI:3386546 from (Arabidopsis thaliana). Interacts with LKP2 and FKF1, but its overexpression does not change flowering time under short or long day conditions.
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence (By similarity). Regulates a photoperiodic flowering response. Transcriptional repressor of 'CONSTANS' expression. {ECO:0000250, ECO:0000269|PubMed:19619493}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00394DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G47500.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Circadian-regulation. Highly expressed at the beginning of the light period, then decreases, reaching a minimum between 16 and 29 hours after dawn before rising again at the end of the day. {ECO:0000269|PubMed:19619493}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Interaction ? help Back to Top
Source Intact With
IntActSearch Q8LFV3
Phenotype -- Disruption Phenotype ? help Back to Top
Source Description
UniProtDISRUPTION PHENOTYPE: No alteration in flowering time, probably due to the redundancy with CDF1, CDF2 and CDF5. {ECO:0000269|PubMed:19619493}.
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G47500
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY1287570.0AY128757.1 Arabidopsis thaliana H-protein promoter binding factor-2a (At3g47500) mRNA, complete cds.
GenBankAY0651520.0AY065152.1 Arabidopsis thaliana H-protein promoter binding factor-2a (At3g47500; F1P2.50) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_190334.10.0cyclic DOF factor 3
SwissprotQ8LFV30.0CDF3_ARATH; Cyclic dof factor 3
TrEMBLD7LNE30.0D7LNE3_ARALL; Predicted protein
STRINGAT3G47500.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3817445
MalvidsOGEM54412848
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Yanagisawa S
    The Dof family of plant transcription factors.
    Trends Plant Sci., 2002. 7(12): p. 555-60
    [PMID:12475498]
  3. Kreps JA, et al.
    Transcriptome changes for Arabidopsis in response to salt, osmotic, and cold stress.
    Plant Physiol., 2002. 130(4): p. 2129-41
    [PMID:12481097]
  4. Hudson ME,Lisch DR,Quail PH
    The FHY3 and FAR1 genes encode transposase-related proteins involved in regulation of gene expression by the phytochrome A-signaling pathway.
    Plant J., 2003. 34(4): p. 453-71
    [PMID:12753585]
  5. Lijavetzky D,Carbonero P,Vicente-Carbajosa J
    Genome-wide comparative phylogenetic analysis of the rice and Arabidopsis Dof gene families.
    BMC Evol. Biol., 2003. 3: p. 17
    [PMID:12877745]
  6. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  7. Tepperman JM, et al.
    Expression profiling of phyB mutant demonstrates substantial contribution of other phytochromes to red-light-regulated gene expression during seedling de-etiolation.
    Plant J., 2004. 38(5): p. 725-39
    [PMID:15144375]
  8. Vogel JT,Zarka DG,Van Buskirk HA,Fowler SG,Thomashow MF
    Roles of the CBF2 and ZAT12 transcription factors in configuring the low temperature transcriptome of Arabidopsis.
    Plant J., 2005. 41(2): p. 195-211
    [PMID:15634197]
  9. Imaizumi T,Schultz TF,Harmon FG,Ho LA,Kay SA
    FKF1 F-box protein mediates cyclic degradation of a repressor of CONSTANS in Arabidopsis.
    Science, 2005. 309(5732): p. 293-7
    [PMID:16002617]
  10. Delessert C, et al.
    The transcription factor ATAF2 represses the expression of pathogenesis-related genes in Arabidopsis.
    Plant J., 2005. 43(5): p. 745-57
    [PMID:16115070]
  11. Khanna R, et al.
    Functional profiling reveals that only a small number of phytochrome-regulated early-response genes in Arabidopsis are necessary for optimal deetiolation.
    Plant Cell, 2006. 18(9): p. 2157-71
    [PMID:16891401]
  12. Chawade A,Br
    Putative cold acclimation pathways in Arabidopsis thaliana identified by a combined analysis of mRNA co-expression patterns, promoter motifs and transcription factors.
    BMC Genomics, 2007. 8: p. 304
    [PMID:17764576]
  13. Ascencio-Ib
    Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection.
    Plant Physiol., 2008. 148(1): p. 436-54
    [PMID:18650403]
  14. Borges F, et al.
    Comparative transcriptomics of Arabidopsis sperm cells.
    Plant Physiol., 2008. 148(2): p. 1168-81
    [PMID:18667720]
  15. Wang Y, et al.
    Transcriptome analyses show changes in gene expression to accompany pollen germination and tube growth in Arabidopsis.
    Plant Physiol., 2008. 148(3): p. 1201-11
    [PMID:18775970]
  16. Fornara F, et al.
    Arabidopsis DOF transcription factors act redundantly to reduce CONSTANS expression and are essential for a photoperiodic flowering response.
    Dev. Cell, 2009. 17(1): p. 75-86
    [PMID:19619493]
  17. Jung CH,Wong CE,Singh MB,Bhalla PL
    Comparative genomic analysis of soybean flowering genes.
    PLoS ONE, 2012. 7(6): p. e38250
    [PMID:22679494]