PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G44350.2
Common Nameanac061, NAC061
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 241aa    MW: 26924.3 Da    PI: 8.6371
Description NAC domain containing protein 61
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G44350.2genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM128.64.8e-4061362128
          NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk....kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                   +GfrF Pt+ el+++yL+ ++ g + ++++ i+ +d+++veP +Lp+    +++++ ++w fF++r++++a+g r++r+t sgyWkatg+  +v+s 
  AT3G44350.2   6 SVGFRFYPTEVELLTYYLRIQLGGGNATIHSLIPILDVFSVEPTQLPNlageRCRGDAEQWIFFVPRQEREARGGRPSRTTGSGYWKATGSPGPVFSP 103
                  68***************************999**************9656766667888*************************************** PP

          NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                  +++++g+kkt+vfy+g+ap+g+kt+W m+ey++
  AT3G44350.2 104 DNRVIGVKKTMVFYTGKAPTGRKTKWKMNEYKA 136
                  *******************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.62E-434160IPR003441NAC domain
PROSITE profilePS5100545.5955160IPR003441NAC domain
PfamPF023651.7E-197135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007275Biological Processmulticellular organism development
GO:0010200Biological Processresponse to chitin
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000293anatomyguard cell
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009047anatomystem
PO:0025022anatomycollective leaf structure
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 241 aa     Download sequence    Send to blast
MGEELSVGFR FYPTEVELLT YYLRIQLGGG NATIHSLIPI LDVFSVEPTQ LPNLAGERCR  60
GDAEQWIFFV PRQEREARGG RPSRTTGSGY WKATGSPGPV FSPDNRVIGV KKTMVFYTGK  120
APTGRKTKWK MNEYKAVETA SVSTIPKLRP EFSICRIYIK SGSSRAFDRR PTEAYAIERN  180
LPSNGVETSS RATISTSPET SHSGGNQVDL PVNATTITQS ISDMVDELSQ PFWEWEQMNW  240
S
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-34516517170NO APICAL MERISTEM PROTEIN
1ut4_B3e-34516517170NO APICAL MERISTEM PROTEIN
1ut7_A3e-34516517170NO APICAL MERISTEM PROTEIN
1ut7_B3e-34516517170NO APICAL MERISTEM PROTEIN
3swm_A4e-34516520173NAC domain-containing protein 19
3swm_B4e-34516520173NAC domain-containing protein 19
3swm_C4e-34516520173NAC domain-containing protein 19
3swm_D4e-34516520173NAC domain-containing protein 19
3swp_A4e-34516520173NAC domain-containing protein 19
3swp_B4e-34516520173NAC domain-containing protein 19
3swp_C4e-34516520173NAC domain-containing protein 19
3swp_D4e-34516520173NAC domain-containing protein 19
4dul_A3e-34516517170NAC domain-containing protein 19
4dul_B3e-34516517170NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.493940.0leaf
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible252681_at0.0
Expression AtlasAT3G44350-
AtGenExpressAT3G44350-
ATTED-IIAT3G44350-
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G44350.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G44350
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0026861e-159CP002686.1 Arabidopsis thaliana chromosome 3, complete sequence.
GenBankAL1386411e-159AL138641.2 Arabidopsis thaliana DNA chromosome 3, BAC clone T22K7.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001118771.11e-179putative NAC domain-containing protein 61
SwissprotQ9M2901e-167NAC61_ARATH; Putative NAC domain-containing protein 61
TrEMBLB3H5061e-179B3H506_ARATH; Putative NAC domain-containing protein 61
STRINGAT3G44350.21e-179(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP22781136
MalvidsOGEM14452893
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Ooka H, et al.
    Comprehensive analysis of NAC family genes in Oryza sativa and Arabidopsis thaliana.
    DNA Res., 2003. 10(6): p. 239-47
    [PMID:15029955]
  3. Libault M,Wan J,Czechowski T,Udvardi M,Stacey G
    Identification of 118 Arabidopsis transcription factor and 30 ubiquitin-ligase genes responding to chitin, a plant-defense elicitor.
    Mol. Plant Microbe Interact., 2007. 20(8): p. 900-11
    [PMID:17722694]