PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G44290.1
Common Nameanac060, NAC060, NAC60, NTL5, T10D17.80
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 335aa    MW: 38062.5 Da    PI: 5.2949
Description NAC domain containing protein 60
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G44290.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM153.11.3e-47151402128
          NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 
                   pGf+F+Ptd el+++yLk+k++g + ++ e+i+ev+iy++ePwdLp k++ ++++ew+fF+ r kky++g++++ratk gyWkatgk+++v+s ++e
  AT3G44290.1  15 FPGFKFSPTDIELISYYLKRKMDGLERSV-EIIPEVEIYNFEPWDLPdKSIVKSDSEWFFFCARGKKYPHGSQNRRATKIGYWKATGKERNVKS-GSE 110
                  59************************999.89***************778888899**************************************.9** PP

          NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                  ++g+k+tLvf+ grapkg +t+W+mhey +
  AT3G44290.1 111 VIGTKRTLVFHIGRAPKGGRTEWLMHEYCM 140
                  ****************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.96E-5113155IPR003441NAC domain
PROSITE profilePS5100550.40214156IPR003441NAC domain
PfamPF023653.8E-2416139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007275Biological Processmulticellular organism development
GO:0071333Biological Processcellular response to glucose stimulus
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 335 aa     Download sequence    Send to blast
MAAAPPIEPA VTTTFPGFKF SPTDIELISY YLKRKMDGLE RSVEIIPEVE IYNFEPWDLP  60
DKSIVKSDSE WFFFCARGKK YPHGSQNRRA TKIGYWKATG KERNVKSGSE VIGTKRTLVF  120
HIGRAPKGGR TEWLMHEYCM IGVSLDALVI CRLRRNTEFQ GSTIQKPPQP SLPLDKHVNL  180
RNEAISESIY GWETMVDFYL SSESGQELLS EIAESSQSSQ NPQVPSEEDF YADILRDEIV  240
KLDDPAVSGN TLINVPRLQT ESNTTRVLPL PDMVDKQMQS LLQKLPLQND TGEENNISMS  300
NCFIGIYSIK SINRARWDVV VWLLVMIAVL VFYLV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A5e-411615622168NAC domain-containing protein 19
3swm_B5e-411615622168NAC domain-containing protein 19
3swm_C5e-411615622168NAC domain-containing protein 19
3swm_D5e-411615622168NAC domain-containing protein 19
3swp_A5e-411615622168NAC domain-containing protein 19
3swp_B5e-411615622168NAC domain-containing protein 19
3swp_C5e-411615622168NAC domain-containing protein 19
3swp_D5e-411615622168NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.361670.0bud
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasAT3G44290
AtGenExpressAT3G44290
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, rosette leaves, cauline leaves, shoot apex, stems and flowers. {ECO:0000269|PubMed:17158162}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP) (By similarity). Transcription factor involved in modulation of abscisic acid (ABA) signaling. Attenuates ABA sensitivity and glucose-induced ABA accumulation. Reduces the expression of ABI4 gene. {ECO:0000250|UniProtKB:Q949N0, ECO:0000269|PubMed:24625790}.
Function -- GeneRIF ? help Back to Top
  1. Chromatin immunoprecipitation-qPCR and transient expression analysis showed that ABI4 directly binds to the GSQ11/ANAC060 promoter to activate transcription
    [PMID: 24625790]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G44290.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By glucose (PubMed:24625790). Induced by salt, drought stress and methyl methanesulfonate (MMS) treatment (PubMed:17158162). {ECO:0000269|PubMed:17158162, ECO:0000269|PubMed:24625790}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G44290
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_190015.10.0NAC domain containing protein 60
SwissprotQ9LXL90.0NAC60_ARATH; NAC domain-containing protein 60
TrEMBLR0HPC60.0R0HPC6_9BRAS; Uncharacterized protein
STRINGAT3G44290.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP10249610
MalvidsOGEM43092356
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Castelli V, et al.
    Whole genome sequence comparisons and "full-length" cDNA sequences: a combined approach to evaluate and improve Arabidopsis genome annotation.
    Genome Res., 2004. 14(3): p. 406-13
    [PMID:14993207]
  3. Ooka H, et al.
    Comprehensive analysis of NAC family genes in Oryza sativa and Arabidopsis thaliana.
    DNA Res., 2003. 10(6): p. 239-47
    [PMID:15029955]
  4. Kim SY, et al.
    Exploring membrane-associated NAC transcription factors in Arabidopsis: implications for membrane biology in genome regulation.
    Nucleic Acids Res., 2007. 35(1): p. 203-13
    [PMID:17158162]
  5. Li P, et al.
    The ABI4-induced Arabidopsis ANAC060 transcription factor attenuates ABA signaling and renders seedlings sugar insensitive when present in the nucleus.
    PLoS Genet., 2014. 10(3): p. e1004213
    [PMID:24625790]