PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G30530.1
Common NameATBZIP42, bZIP42
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family bZIP
Protein Properties Length: 173aa    MW: 20301.6 Da    PI: 5.6533
Description basic leucine-zipper 42
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G30530.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_148.51.9e-1581139563
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                  +++rr+++NRe+ArrsR RK+  ++eL   v  L  eN++L ++l++l++  +k+ +e+
  AT3G30530.1  81 RKQRRMISNRESARRSRMRKQRHLDELWSQVMWLRIENHQLLDKLNNLSESHDKVLQEN 139
                  689*************************************************9999987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.7E-1477141IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.87579142IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.9E-1179133No hitNo description
PfamPF001706.9E-1481139IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.81E-1381131No hitNo description
CDDcd147026.02E-2082133No hitNo description
PROSITE patternPS0003608499IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000230anatomyinflorescence meristem
PO:0009046anatomyflower
PO:0007611developmental stagepetal differentiation and expansion stage
Sequence ? help Back to Top
Protein Sequence    Length: 173 aa     Download sequence    Send to blast
MQPQTDVFSL HNYLNSSILQ SPYPSNFPIS TPFPTNGQNP YLLYGFQSPT NNPQSMSLSS  60
NNSTSDEAEE QQTNNNIINE RKQRRMISNR ESARRSRMRK QRHLDELWSQ VMWLRIENHQ  120
LLDKLNNLSE SHDKVLQENA QLKEETFELK QVISDMQIQS PFSCFRDDII PIE
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
193100RRSRMRKQ
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible258306_at0.0
Expression AtlasAT3G30530-
AtGenExpressAT3G30530-
ATTED-IIAT3G30530-
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00389DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G30530.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Interaction ? help Back to Top
Source Intact With
BioGRIDAT3G30530, AT5G49450, AT1G13600, AT1G75390
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G30530
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0026860.0CP002686.1 Arabidopsis thaliana chromosome 3, complete sequence.
GenBankAB0168780.0AB016878.1 Arabidopsis thaliana genomic DNA, chromosome 3, P1 clone: MQP15.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_189674.11e-124basic leucine-zipper 42
SwissprotQ9FMC21e-64BZP43_ARATH; Basic leucine zipper 43
TrEMBLQ9LW451e-124Q9LW45_ARATH; Basic leucine-zipper 42
STRINGAT3G30530.11e-124(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP31041129
MalvidsOGEM31122667
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Jakoby M, et al.
    bZIP transcription factors in Arabidopsis.
    Trends Plant Sci., 2002. 7(3): p. 106-11
    [PMID:11906833]
  3. Deppmann CD, et al.
    Dimerization specificity of all 67 B-ZIP motifs in Arabidopsis thaliana: a comparison to Homo sapiens B-ZIP motifs.
    Nucleic Acids Res., 2004. 32(11): p. 3435-45
    [PMID:15226410]
  4. Ehlert A, et al.
    Two-hybrid protein-protein interaction analysis in Arabidopsis protoplasts: establishment of a heterodimerization map of group C and group S bZIP transcription factors.
    Plant J., 2006. 46(5): p. 890-900
    [PMID:16709202]
  5. Deppmann CD,Alvania RS,Taparowsky EJ
    Cross-species annotation of basic leucine zipper factor interactions: Insight into the evolution of closed interaction networks.
    Mol. Biol. Evol., 2006. 23(8): p. 1480-92
    [PMID:16731568]
  6. Efroni I, et al.
    Regulation of leaf maturation by chromatin-mediated modulation of cytokinin responses.
    Dev. Cell, 2013. 24(4): p. 438-45
    [PMID:23449474]