PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G30260.1
Common NameAGL79
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MIKC_MADS
Protein Properties Length: 249aa    MW: 28075.2 Da    PI: 10.1628
Description AGAMOUS-like 79
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G30260.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF91.93.1e-291058250
                 ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
       SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                 rienk++rqvtfskRr+g+ KKA+E+SvLCdaeva+i+fs++gkl+eys
  AT3G30260.1 10 RIENKIRRQVTFSKRRTGLVKKAQEISVLCDAEVALIVFSPKGKLFEYS 58
                 8***********************************************8 PP

2K-box80.34.7e-27891721598
        K-box  15 eslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                   ++++e +kL + i+ Lqr++Rhl Ge+++ Ls+++Lq +e qL+++lkk Rs+Kn+l++e+i +lqkkekel+e +k+L+kk 
  AT3G30260.1  89 GECSTECSKLLRMIDVLQRSLRHLRGEEVDGLSIRDLQGVEMQLDTALKKTRSRKNQLMVESIAQLQKKEKELKELKKQLTKKA 172
                  57899****************************************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004324.2E-37160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006630.908161IPR002100Transcription factor, MADS-box
CDDcd002652.40E-38279No hitNo description
SuperFamilySSF554551.2E-30280IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-28323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003191.6E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-282338IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-283859IPR002100Transcription factor, MADS-box
PfamPF014864.8E-2287171IPR002487Transcription factor, K-box
PROSITE profilePS5129714.24588178IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009005anatomyroot
Sequence ? help Back to Top
Protein Sequence    Length: 249 aa     Download sequence    Send to blast
MGRGRVQLRR IENKIRRQVT FSKRRTGLVK KAQEISVLCD AEVALIVFSP KGKLFEYSAG  60
SSMERILDRY ERSAYAGQDI PTPNLDSQGE CSTECSKLLR MIDVLQRSLR HLRGEEVDGL  120
SIRDLQGVEM QLDTALKKTR SRKNQLMVES IAQLQKKEKE LKELKKQLTK KAGEREDFQT  180
QNLSHDLASL ATPPFESPHE LRRTISPPPP PLSSGDTSQR DGVGEVAAGT LIRRTNATLP  240
HWMPQLTGE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A9e-20170169MEF2C
5f28_B9e-20170169MEF2C
5f28_C9e-20170169MEF2C
5f28_D9e-20170169MEF2C
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible256703_at1e-146
Expression AtlasAT3G30260-
AtGenExpressAT3G30260-
ATTED-IIAT3G30260-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in tendrils and flowers. {ECO:0000269|PubMed:15247405}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in flower development. {ECO:0000250|UniProtKB:Q0HA25}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G30260.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G30260
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY1412380.0AY141238.1 Arabidopsis thaliana MADS-box protein AGL79 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_189645.20.0AGAMOUS-like 79
SwissprotQ6E6S72e-75AP1_VITVI; Agamous-like MADS-box protein AP1
TrEMBLQ7X9H60.0Q7X9H6_ARATH; AGAMOUS-like 79
STRINGAT3G30260.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM130331525
Representative plantOGRP1617761
Publications ? help Back to Top
  1. Parenicová L, et al.
    Molecular and phylogenetic analyses of the complete MADS-box transcription factor family in Arabidopsis: new openings to the MADS world.
    Plant Cell, 2003. 15(7): p. 1538-51
    [PMID:12837945]
  2. Scheible WR, et al.
    Genome-wide reprogramming of primary and secondary metabolism, protein synthesis, cellular growth processes, and the regulatory infrastructure of Arabidopsis in response to nitrogen.
    Plant Physiol., 2004. 136(1): p. 2483-99
    [PMID:15375205]
  3. Albert VA, et al.
    Floral gene resources from basal angiosperms for comparative genomics research.
    BMC Plant Biol., 2005. 5: p. 5
    [PMID:15799777]
  4. Jaillon O, et al.
    The grapevine genome sequence suggests ancestral hexaploidization in major angiosperm phyla.
    Nature, 2007. 449(7161): p. 463-7
    [PMID:17721507]
  5. Díaz-Riquelme J,Lijavetzky D,Martínez-Zapater JM,Carmona MJ
    Genome-wide analysis of MIKCC-type MADS box genes in grapevine.
    Plant Physiol., 2009. 149(1): p. 354-69
    [PMID:18997115]
  6. Grimplet J,Martínez-Zapater JM,Carmona MJ
    Structural and functional annotation of the MADS-box transcription factor family in grapevine.
    BMC Genomics, 2016. 17: p. 80
    [PMID:26818751]