PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G29035.1
Common NameANAC059, ATNAC3, MRI12.1, NAC3, NAC59, ORS1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 318aa    MW: 35825.6 Da    PI: 8.4219
Description NAC domain containing protein 3
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G29035.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM180.83.6e-56241501129
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 
                  lppGfrFhPtdeel+++yL++kv ++ +++  +i evd++kvePwdLp k+k +ekewyfF+ rd+ky+tg r+nratk+gyWkatgkdke+++ +++
  AT3G29035.1  24 LPPGFRFHPTDEELITHYLRPKVVNSFFSA-IAIGEVDLNKVEPWDLPWKAKLGEKEWYFFCVRDRKYPTGLRTNRATKAGYWKATGKDKEIFK-GKS 119
                  79*************************999.88***************888999****************************************.999 PP

          NAM  99 lvglkktLvfykgrapkgektdWvmheyrle 129
                  lvg+kktLvfykgrapkg+kt+Wvmheyrle
  AT3G29035.1 120 LVGMKKTLVFYKGRAPKGVKTNWVMHEYRLE 150
                  *****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.83E-6121174IPR003441NAC domain
PROSITE profilePS5100557.02824174IPR003441NAC domain
PfamPF023653.3E-3025149IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009611Biological Processresponse to wounding
GO:0042542Biological Processresponse to hydrogen peroxide
GO:0051091Biological Processpositive regulation of sequence-specific DNA binding transcription factor activity
GO:1900057Biological Processpositive regulation of leaf senescence
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000230anatomyinflorescence meristem
PO:0000258anatomyroot cortex
PO:0000293anatomyguard cell
PO:0003015anatomyprimary root differentiation zone
PO:0005679anatomyepidermis
PO:0006502anatomyfloral organ abscission zone
PO:0009005anatomyroot
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0020030anatomycotyledon
PO:0020100anatomyhypocotyl
PO:0025034anatomyleaf
PO:0025257anatomyprimary root elongation zone
PO:0025281anatomypollen
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 318 aa     Download sequence    Send to blast
MDYKVSRSGE IVEGEVEDSE KIDLPPGFRF HPTDEELITH YLRPKVVNSF FSAIAIGEVD  60
LNKVEPWDLP WKAKLGEKEW YFFCVRDRKY PTGLRTNRAT KAGYWKATGK DKEIFKGKSL  120
VGMKKTLVFY KGRAPKGVKT NWVMHEYRLE GKFAIDNLSK TAKNECVISR VFHTRTDGTK  180
EHMSVGLPPL MDSSPYLKSR GQDSLAGTTL GGLLSHVTYF SDQTTDDKSL VADFKTTMFG  240
SGSTNFLPNI GSLLDFDPLF LQNNSSVLKM LLDNEETQFK KNLHNSGSSE SELTASSWQG  300
HNSYGSTGPV NLDCVWKF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B1e-50151808171NAC domain-containing protein 19
4dul_A1e-50151808171NAC domain-containing protein 19
1ut7_B1e-50151808171NO APICAL MERISTEM PROTEIN
1ut7_A1e-50151808171NO APICAL MERISTEM PROTEIN
1ut4_B1e-50151808171NO APICAL MERISTEM PROTEIN
1ut4_A1e-50151808171NO APICAL MERISTEM PROTEIN
3swp_D1e-501518011174NAC domain-containing protein 19
3swp_C1e-501518011174NAC domain-containing protein 19
3swp_B1e-501518011174NAC domain-containing protein 19
3swp_A1e-501518011174NAC domain-containing protein 19
3swm_D1e-501518011174NAC domain-containing protein 19
3swm_C1e-501518011174NAC domain-containing protein 19
3swm_B1e-501518011174NAC domain-containing protein 19
3swm_A1e-501518011174NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.272820.0root
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1453390500.0
Genevisible258059_at0.0
Expression AtlasAT3G29035-
AtGenExpressAT3G29035-
ATTED-IIAT3G29035-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Age-dependent accumulation. First observed in young seedlings in cotyledons and regularly in the tip regions of very young leaves. Accumulates strongly in older leaf parts at the senescence onset. In flowers, present in mature organs such as old sepals, petals, old stamens, mature anthers, and pollen grains. Confined to floral organ abscission zone of mature flowers. Also observed in roots. {ECO:0000269|PubMed:21303842}.
UniprotTISSUE SPECIFICITY: Mostly expressed in root cortex, phloem, atrichoblast and quiescent center (QC), and, to a lower extent, in root endodermis, xylem, pericycle, columella and lateral root cap (LRC) (PubMed:16581911). Expressed in roots, cotyledons, very young leaves, senescing leaves, mature flowers and pollen (PubMed:21303842). {ECO:0000269|PubMed:16581911, ECO:0000269|PubMed:21303842}.
Functional Description ? help Back to Top
Source Description
TAIREncodes a protein with transcription factor activity. Note: this protein (AT3G29035) on occasion has also been referred to as AtNAC3, not to be confused with the AtNAC3 found at locus AT3G15500.
UniProtTranscription activator that binds to DNA in promoters of target genes on a specific bipartite motif 5'-[AG]CGT[AG](4-5n)[AG][CT]ACGCAA-3' (PubMed:16359384, PubMed:21303842). Triggers the expression of senescence-associated genes during age-, salt- and dark-induced senescence through a regulatory network that may involve cross-talk with salt- and H(2)O(2)-dependent signaling pathways (PubMed:21303842). {ECO:0000269|PubMed:16359384, ECO:0000269|PubMed:21303842}.
Function -- GeneRIF ? help Back to Top
  1. NAC3 protein could mediate abscisic acid signaling in A. thaliana.
    [PMID: 25290154]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G29035.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Rapidly and strongly induced by H(2)O(2) treatment in both leaves and roots. Accumulates during senescence and in response to wounding. {ECO:0000269|PubMed:21303842}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
BioGRIDAT5G13180, AT1G14920
IntActSearch Q9LJW3
Phenotype -- Disruption Phenotype ? help Back to Top
Source Description
UniProtDISRUPTION PHENOTYPE: Delayed senescence accompanied by a small delay in flowering time. {ECO:0000269|PubMed:21303842}.
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G29035
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0087160.0BT008716.1 Arabidopsis thaliana At3g29035 gene, complete cds.
GenBankAY0626380.0AY062638.1 Arabidopsis thaliana Unknown protein (MRI12.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_189546.10.0NAC domain-containing protein 3
SwissprotQ9LJW30.0NAC59_ARATH; NAC domain-containing protein 59
TrEMBLD7LM770.0D7LM77_ARALL; ANAC059/ATNAC3
STRINGAT3G29035.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1715800
MalvidsOGEM40028174
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  3. Ooka H, et al.
    Comprehensive analysis of NAC family genes in Oryza sativa and Arabidopsis thaliana.
    DNA Res., 2003. 10(6): p. 239-47
    [PMID:15029955]
  4. Mallory AC,Dugas DV,Bartel DP,Bartel B
    MicroRNA regulation of NAC-domain targets is required for proper formation and separation of adjacent embryonic, vegetative, and floral organs.
    Curr. Biol., 2004. 14(12): p. 1035-46
    [PMID:15202996]
  5. Kasukabe Y, et al.
    Overexpression of spermidine synthase enhances tolerance to multiple environmental stresses and up-regulates the expression of various stress-regulated genes in transgenic Arabidopsis thaliana.
    Plant Cell Physiol., 2004. 45(6): p. 712-22
    [PMID:15215506]
  6. Tian L, et al.
    Reversible histone acetylation and deacetylation mediate genome-wide, promoter-dependent and locus-specific changes in gene expression during plant development.
    Genetics, 2005. 169(1): p. 337-45
    [PMID:15371352]
  7. Nagata T,Yamada H,Du Z,Todoriki S,Kikuchi S
    Microarray analysis of genes that respond to gamma-irradiation in Arabidopsis.
    J. Agric. Food Chem., 2005. 53(4): p. 1022-30
    [PMID:15713015]
  8. He XJ, et al.
    AtNAC2, a transcription factor downstream of ethylene and auxin signaling pathways, is involved in salt stress response and lateral root development.
    Plant J., 2005. 44(6): p. 903-16
    [PMID:16359384]
  9. Lee JY, et al.
    Transcriptional and posttranscriptional regulation of transcription factor expression in Arabidopsis roots.
    Proc. Natl. Acad. Sci. U.S.A., 2006. 103(15): p. 6055-60
    [PMID:16581911]
  10. Mace DL, et al.
    Quantification of transcription factor expression from Arabidopsis images.
    Bioinformatics, 2006. 22(14): p. e323-31
    [PMID:16873489]
  11. Ballvora A, et al.
    Comparative sequence analysis of Solanum and Arabidopsis in a hot spot for pathogen resistance on potato chromosome V reveals a patchwork of conserved and rapidly evolving genome segments.
    BMC Genomics, 2007. 8: p. 112
    [PMID:17474978]
  12. Balazadeh S, et al.
    ORS1, an H₂O₂-responsive NAC transcription factor, controls senescence in Arabidopsis thaliana.
    Mol Plant, 2011. 4(2): p. 346-60
    [PMID:21303842]
  13. Arabidopsis Interactome Mapping Consortium
    Evidence for network evolution in an Arabidopsis interactome map.
    Science, 2011. 333(6042): p. 601-7
    [PMID:21798944]
  14. Matallana-Ramirez LP, et al.
    NAC transcription factor ORE1 and senescence-induced BIFUNCTIONAL NUCLEASE1 (BFN1) constitute a regulatory cascade in Arabidopsis.
    Mol Plant, 2013. 6(5): p. 1438-52
    [PMID:23340744]
  15. Pei H, et al.
    An NAC transcription factor controls ethylene-regulated cell expansion in flower petals.
    Plant Physiol., 2013. 163(2): p. 775-91
    [PMID:23933991]
  16. Mar
    Large-scale identification of gibberellin-related transcription factors defines group VII ETHYLENE RESPONSE FACTORS as functional DELLA partners.
    Plant Physiol., 2014. 166(2): p. 1022-32
    [PMID:25118255]
  17. Jiang G, et al.
    The rose (Rosa hybrida) NAC transcription factor 3 gene, RhNAC3, involved in ABA signaling pathway both in rose and Arabidopsis.
    PLoS ONE, 2014. 9(10): p. e109415
    [PMID:25290154]