PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G28917.1
Common NameMIF2, MLD15.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family ZF-HD
Protein Properties Length: 100aa    MW: 10793.1 Da    PI: 8.2928
Description mini zinc finger 2
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G28917.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer107.95.8e-343087360
  ZF-HD_dimer  3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60
                 +vrY eC+kNhAa++Gg+avDGC+Efm+s+geegt+aal+CaACgCHR+FHRre e+e
  AT3G28917.1 30 TVRYGECQKNHAAAVGGYAVDGCREFMASRGEEGTVAALTCAACGCHRSFHRREIETE 87
                 79****************************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257746.0E-34197IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047702.3E-293184IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015664.0E-283284IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152324.6423383IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007275Biological Processmulticellular organism development
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0046872Molecular Functionmetal ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009001anatomyfruit
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009049anatomyinflorescence
Sequence ? help Back to Top
Protein Sequence    Length: 100 aa     Download sequence    Send to blast
MRKRQVVLRR ASPEEPSRSS STASSLTVRT VRYGECQKNH AAAVGGYAVD GCREFMASRG  60
EEGTVAALTC AACGCHRSFH RREIETEVVC DCNSPPSTGN
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.479381e-152flower| leaf
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasAT3G28917
AtGenExpressAT3G28917
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Mostly expressed in stems, flowers and siliques, and, to a lower extent, in inflorescence. {ECO:0000269|PubMed:16412086}.
Functional Description ? help Back to Top
Source Description
UniProtInhibits zinc finger homeodomain (ZHD) transcription factors by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by regulating the expression of specific genes. {ECO:0000269|PubMed:21455630}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G28917.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G28917
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0026861e-169CP002686.1 Arabidopsis thaliana chromosome 3, complete sequence.
GenBankBT0246631e-169BT024663.1 Arabidopsis thaliana unknown protein (At3g28917) mRNA, complete cds.
GenBankAP0003861e-169AP000386.1 Arabidopsis thaliana genomic DNA, chromosome 3, P1 clone:MLD15.
GenBankAK2210941e-169AK221094.1 Arabidopsis thaliana mRNA for hypothetical protein, complete cds, clone: RAFL22-84-D24.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_974373.15e-68mini zinc finger 2
RefseqXP_006292529.15e-68hypothetical protein CARUB_v10018759mg
SwissprotQ9LJW57e-70MIF2_ARATH; Mini zinc finger protein 2
TrEMBLR0FRW76e-68R0FRW7_9BRAS; Uncharacterized protein
STRINGAT3G28917.12e-67(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9116237
MalvidsOGEM94428114
Publications ? help Back to Top
  1. Hu W,Ma H
    Characterization of a novel putative zinc finger gene MIF1: involvement in multiple hormonal regulation of Arabidopsis development.
    Plant J., 2006. 45(3): p. 399-422
    [PMID:16412086]
  2. Hu W,dePamphilis CW,Ma H
    Phylogenetic analysis of the plant-specific zinc finger-homeobox and mini zinc finger gene families.
    J Integr Plant Biol, 2008. 50(8): p. 1031-45
    [PMID:18713354]
  3. Rehrauer H, et al.
    AGRONOMICS1: a new resource for Arabidopsis transcriptome profiling.
    Plant Physiol., 2010. 152(2): p. 487-99
    [PMID:20032078]
  4. Hong SY,Kim OK,Kim SG,Yang MS,Park CM
    Nuclear import and DNA binding of the ZHD5 transcription factor is modulated by a competitive peptide inhibitor in Arabidopsis.
    J. Biol. Chem., 2011. 286(2): p. 1659-68
    [PMID:21059647]
  5. Hu W,Feng B,Ma H
    Ectopic expression of the Arabidopsis MINI ZINC FINGER1 and MIF3 genes induces shoot meristems on leaf margins.
    Plant Mol. Biol., 2011. 76(1-2): p. 57-68
    [PMID:21455630]