PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G28917.1
Common NameMIF2, MLD15.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family ZF-HD
Protein Properties Length: 100aa    MW: 10793.1 Da    PI: 8.2928
Description mini zinc finger 2
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G28917.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer107.95.8e-343087360
  ZF-HD_dimer  3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60
                 +vrY eC+kNhAa++Gg+avDGC+Efm+s+geegt+aal+CaACgCHR+FHRre e+e
  AT3G28917.1 30 TVRYGECQKNHAAAVGGYAVDGCREFMASRGEEGTVAALTCAACGCHRSFHRREIETE 87
                 79****************************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257746.0E-34197IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047702.3E-293184IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015664.0E-283284IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152324.6423383IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007275Biological Processmulticellular organism development
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0046872Molecular Functionmetal ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009001anatomyfruit
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009049anatomyinflorescence
Sequence ? help Back to Top
Protein Sequence    Length: 100 aa     Download sequence    Send to blast
MRKRQVVLRR ASPEEPSRSS STASSLTVRT VRYGECQKNH AAAVGGYAVD GCREFMASRG  60
EEGTVAALTC AACGCHRSFH RREIETEVVC DCNSPPSTGN
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.479381e-152flower| leaf
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasAT3G28917
AtGenExpressAT3G28917
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Mostly expressed in stems, flowers and siliques, and, to a lower extent, in inflorescence. {ECO:0000269|PubMed:16412086}.
Functional Description ? help Back to Top
Source Description
UniProtInhibits zinc finger homeodomain (ZHD) transcription factors by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by regulating the expression of specific genes. {ECO:0000269|PubMed:21455630}.
Function -- GeneRIF ? help Back to Top
  1. Arabidopsis thaliana MINI ZINC FINGER2 (AtMIF2) and its homolog in tomato (Solanum lycopersicum), INHIBITOR OF MERISTEM ACTIVITY (SlIMA), participate in the floral meristem termination process by functioning as adaptor proteins.
    [PMID: 29298836]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G28917.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G28917
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2210941e-169AK221094.1 Arabidopsis thaliana mRNA for hypothetical protein, complete cds, clone: RAFL22-84-D24.
GenBankAP0003861e-169AP000386.1 Arabidopsis thaliana genomic DNA, chromosome 3, P1 clone:MLD15.
GenBankBT0246631e-169BT024663.1 Arabidopsis thaliana unknown protein (At3g28917) mRNA, complete cds.
GenBankCP0026861e-169CP002686.1 Arabidopsis thaliana chromosome 3, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_974373.11e-67mini zinc finger 2
RefseqXP_006292529.11e-67mini zinc finger protein 2
SwissprotQ9LJW59e-69MIF2_ARATH; Mini zinc finger protein 2
TrEMBLR0FRW72e-66R0FRW7_9BRAS; Uncharacterized protein
STRINGCagra.0498s0002.1.p4e-67(Capsella grandiflora)
STRINGAT3G28917.14e-67(Arabidopsis thaliana)
STRINGXP_006292529.14e-67(Capsella rubella)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM94428114
Representative plantOGRP9116237
Publications ? help Back to Top
  1. Hu W,Ma H
    Characterization of a novel putative zinc finger gene MIF1: involvement in multiple hormonal regulation of Arabidopsis development.
    Plant J., 2006. 45(3): p. 399-422
    [PMID:16412086]
  2. Hu W,dePamphilis CW,Ma H
    Phylogenetic analysis of the plant-specific zinc finger-homeobox and mini zinc finger gene families.
    J Integr Plant Biol, 2008. 50(8): p. 1031-45
    [PMID:18713354]
  3. Rehrauer H, et al.
    AGRONOMICS1: a new resource for Arabidopsis transcriptome profiling.
    Plant Physiol., 2010. 152(2): p. 487-99
    [PMID:20032078]
  4. Hong SY,Kim OK,Kim SG,Yang MS,Park CM
    Nuclear import and DNA binding of the ZHD5 transcription factor is modulated by a competitive peptide inhibitor in Arabidopsis.
    J. Biol. Chem., 2011. 286(2): p. 1659-68
    [PMID:21059647]
  5. Hu W,Feng B,Ma H
    Ectopic expression of the Arabidopsis MINI ZINC FINGER1 and MIF3 genes induces shoot meristems on leaf margins.
    Plant Mol. Biol., 2011. 76(1-2): p. 57-68
    [PMID:21455630]
  6. Bollier N, et al.
    At-MINI ZINC FINGER2 and Sl-INHIBITOR OF MERISTEM ACTIVITY, a Conserved Missing Link in the Regulation of Floral Meristem Termination in Arabidopsis and Tomato.
    Plant Cell, 2018. 30(1): p. 83-100
    [PMID:29298836]