PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G28470.1
Common NameATMYB35, MFJ20.16, MYB35, TDF1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 317aa    MW: 35812.9 Da    PI: 6.985
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G28470.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.43.2e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WT+eEd +++ +v+ +G g+W++I+++ g++R++k+c++rw +yl
      AT3G28470.1 14 KGLWTEEEDAKILAYVAIHGVGNWSLIPKKAGLNRCGKSCRLRWTNYL 61
                     678*******************************************97 PP

2Myb_DNA-binding51.62.2e-1669110346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +++t+E+el++++++  G++ W++Iar+++ gRt++++k++w++
      AT3G28470.1  69 SFSTQEEELIIECHRAIGSR-WSSIARKLP-GRTDNDVKNHWNT 110
                      79******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.7E-25564IPR009057Homeodomain-like
PROSITE profilePS5129427.917965IPR017930Myb domain
SuperFamilySSF466893.26E-3011108IPR009057Homeodomain-like
SMARTSM007172.3E-161363IPR001005SANT/Myb domain
PfamPF002491.3E-161461IPR001005SANT/Myb domain
CDDcd001671.98E-131761No hitNo description
Gene3DG3DSA:1.10.10.601.2E-2265116IPR009057Homeodomain-like
SMARTSM007174.1E-1466114IPR001005SANT/Myb domain
PROSITE profilePS5129418.73566116IPR017930Myb domain
CDDcd001673.27E-1069110No hitNo description
PfamPF002495.1E-1469110IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0030154Biological Processcell differentiation
GO:0048658Biological Processanther wall tapetum development
GO:0052545Biological Processcallose localization
GO:0055046Biological Processmicrogametogenesis
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009010anatomyseed
PO:0009031anatomysepal
PO:0009046anatomyflower
PO:0009049anatomyinflorescence
PO:0009071anatomyanther wall tapetum
PO:0020047anatomymicrosporocyte
PO:0025022anatomycollective leaf structure
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0007611developmental stagepetal differentiation and expansion stage
Sequence ? help Back to Top
Protein Sequence    Length: 317 aa     Download sequence    Send to blast
MGRPPCCDKS NVKKGLWTEE EDAKILAYVA IHGVGNWSLI PKKAGLNRCG KSCRLRWTNY  60
LRPDLKHDSF STQEEELIIE CHRAIGSRWS SIARKLPGRT DNDVKNHWNT KLKKKLMKMG  120
IDPVTHKPVS QLLAEFRNIS GHGNASFKTE PSNNSILTQS NSAWEMMRNT TTNHESYYTN  180
SPMMFTNSSE YQTTPFHFYS HPNHLLNGTT SSCSSSSSST SITQPNQVPQ TPVTNFYWSD  240
FLLSDPVPQV VGSSATSDLT FTQNEHHFNI EAEYISQNID SKASGTCHSA SSFVDEILDK  300
DQEMLSQFPQ LLNDFDY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-29141167108B-MYB
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO306892090.0
Genevisible257904_at0.0
Expression AtlasAT3G28470-
AtGenExpressAT3G28470-
ATTED-IIAT3G28470-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: During anther development, first confined to meiocytes, tapetal and middle layer cells. At the microspore stage, mainly expressed in the tapetum and microspores. Later observed in developing pollen grains. {ECO:0000269|PubMed:18397379, ECO:0000269|PubMed:21957980}.
UniprotTISSUE SPECIFICITY: Inflorescences-specific (PubMed:18397379). Accumulates in anthers, especially in tapetum and meiocytes/microsporocytes and microspores during anther development (PubMed:17666023, PubMed:18397379). {ECO:0000269|PubMed:17666023, ECO:0000269|PubMed:18397379}.
Functional Description ? help Back to Top
Source Description
TAIRMember of the R2R3 factor gene family.
UniProtRequired for anther development and early tapetal function during microspore maturation (PubMed:18397379, PubMed:21957980). Regulates callose dissolution required for microspores release from the tetrads (PubMed:18397379). {ECO:0000269|PubMed:18397379, ECO:0000269|PubMed:21957980}.
Function -- GeneRIF ? help Back to Top
  1. The identification and characterization of TDF1 as a synonym for MYB35 using a map-based cloning strategy is reported.
    [PMID: 18397379]
  2. DYT1, TDF1 and AMS function in early tapetum development, while MS188 and MS1 are important for late tapetum development.
    [PMID: 21957980]
  3. DYT1 regulates the expression of AMS, MS188/MYB80, TEK and MS1 for pollen wall formation, primarily via TDF1.
    [PMID: 25284309]
  4. The TDF1-AMS complex acts in concert to activate EXPB5 expression through a feed-forward loop. The identification of the regulatory pathway between TDF1 and AMS provides an interlocked feed-forward loop circuit that precisely regulates the transcriptional cascades that support anther development.
    [PMID: 28940573]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G28470.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Upstream Regulators) ? help Back to Top
Source Upstream Regulator (A: Activate/R: Repress)
ATRM AT4G21330 (A)
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT5G56110(A)
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDBrassinosteroid
Phenotype -- Disruption Phenotype ? help Back to Top
Source Description
UniProtDISRUPTION PHENOTYPE: Male-sterile mutant, defective in tapetal development, characterized by irregular and excessive division, redundant cells and leading to dysfunction of the tapetum (PubMed:18397379, PubMed:21957980). Impaired callose dissolution resulting in altered microspores release from the tetrads and no pollen production (PubMed:18397379). {ECO:0000269|PubMed:18397379, ECO:0000269|PubMed:21957980}.
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G28470
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5195910.0AY519591.1 Arabidopsis thaliana MYB transcription factor (At3g28470) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_189488.10.0Duplicated homeodomain-like superfamily protein
SwissprotQ9LSI70.0MYB35_ARATH; Transcription factor MYB35
TrEMBLA0A178VQ250.0A0A178VQ25_ARATH; TDF1
STRINGAT3G28470.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Representative plantOGRP5171784
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  3. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  4. Zhang W, et al.
    Regulation of Arabidopsis tapetum development and function by DYSFUNCTIONAL TAPETUM1 (DYT1) encoding a putative bHLH transcription factor.
    Development, 2006. 133(16): p. 3085-95
    [PMID:16831835]
  5. Underwood BA,Vanderhaeghen R,Whitford R,Town CD,Hilson P
    Simultaneous high-throughput recombinational cloning of open reading frames in closed and open configurations.
    Plant Biotechnol. J., 2006. 4(3): p. 317-24
    [PMID:17147637]
  6. Wijeratne AJ, et al.
    Differential gene expression in Arabidopsis wild-type and mutant anthers: insights into anther cell differentiation and regulatory networks.
    Plant J., 2007. 52(1): p. 14-29
    [PMID:17666023]
  7. Xing S,Zachgo S
    ROXY1 and ROXY2, two Arabidopsis glutaredoxin genes, are required for anther development.
    Plant J., 2008. 53(5): p. 790-801
    [PMID:18036205]
  8. Zhu J, et al.
    Defective in Tapetal development and function 1 is essential for anther development and tapetal function for microspore maturation in Arabidopsis.
    Plant J., 2008. 55(2): p. 266-77
    [PMID:18397379]
  9. Zhu J,Lou Y,Xu X,Yang ZN
    A genetic pathway for tapetum development and function in Arabidopsis.
    J Integr Plant Biol, 2011. 53(11): p. 892-900
    [PMID:21957980]
  10. Feng B, et al.
    Regulation of the Arabidopsis anther transcriptome by DYT1 for pollen development.
    Plant J., 2012. 72(4): p. 612-24
    [PMID:22775442]
  11. Efroni I, et al.
    Regulation of leaf maturation by chromatin-mediated modulation of cytokinin responses.
    Dev. Cell, 2013. 24(4): p. 438-45
    [PMID:23449474]
  12. Gu JN, et al.
    DYT1 directly regulates the expression of TDF1 for tapetum development and pollen wall formation in Arabidopsis.
    Plant J., 2014. 80(6): p. 1005-13
    [PMID:25284309]
  13. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]
  14. Tsugama D, et al.
    A putative MYB35 ortholog is a candidate for the sex-determining genes in Asparagus officinalis.
    Sci Rep, 2017. 7: p. 41497
    [PMID:28176806]
  15. Lou Y, et al.
    Positive regulation of AMS by TDF1 and the formation of a TDF1-AMS complex are required for anther development in Arabidopsis thaliana.
    New Phytol., 2018. 217(1): p. 378-391
    [PMID:28940573]
  16. Li DD,Xue JS,Zhu J,Yang ZN
    Gene Regulatory Network for Tapetum Development in Arabidopsis thaliana.
    Front Plant Sci, 2017. 8: p. 1559
    [PMID:28955355]
  17. Kranz HD, et al.
    Towards functional characterisation of the members of the R2R3-MYB gene family from Arabidopsis thaliana.
    Plant J., 1998. 16(2): p. 263-76
    [PMID:9839469]