PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G27785.1
Common NameATMYB118, MYB118, PGA37
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 437aa    MW: 49492.1 Da    PI: 7.6888
Description myb domain protein 118
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G27785.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.92.7e-19189235148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WT+eEd+llv++v ++G++ W+ Ia++++ gR +kqc++rw+++l
      AT3G27785.1 189 KGQWTPEEDKLLVQLVDLHGTKKWSQIAKMLQ-GRVGKQCRERWHNHL 235
                      799*****************************.*************97 PP

2Myb_DNA-binding55.51.3e-17242283245
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      + WT+eEd +l++a+k+ G++ W+ Iar+++ gRt++ +k++w+
      AT3G27785.1 242 DGWTEEEDIILIKAHKEIGNR-WAEIARKLP-GRTENTIKNHWN 283
                      56*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129430.877184239IPR017930Myb domain
SuperFamilySSF466893.95E-32186282IPR009057Homeodomain-like
SMARTSM007174.2E-17188237IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.3E-28190241IPR009057Homeodomain-like
CDDcd001673.18E-15192235No hitNo description
PfamPF139216.5E-20192250No hitNo description
SMARTSM007173.1E-16240288IPR001005SANT/Myb domain
PROSITE profilePS5129420.737240290IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.5E-21242288IPR009057Homeodomain-like
CDDcd001671.24E-12244286No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0010439Biological Processregulation of glucosinolate biosynthetic process
GO:0030154Biological Processcell differentiation
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1904095Biological Processnegative regulation of endosperm development
GO:2000692Biological Processnegative regulation of seed maturation
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000014anatomyrosette leaf
PO:0009001anatomyfruit
PO:0009009anatomyplant embryo
PO:0009046anatomyflower
Sequence ? help Back to Top
Protein Sequence    Length: 437 aa     Download sequence    Send to blast
MEFESVFKMH YPYLAAVIYD DSSTLKDFHP SLTDDFSCVH NVHHKPSMPH TYEIPSKETI  60
RGITPSPCTE AFEACFHGTS NDHVFFGMAY TTPPTIEPNV SHVSHDNTMW ENDQNQGFIF  120
GTESTLNQAM ADSNQFNMPK PLLSANEDTI MNRRQNNQVM IKTEQIKKKN KRFQMRRICK  180
PTKKASIIKG QWTPEEDKLL VQLVDLHGTK KWSQIAKMLQ GRVGKQCRER WHNHLRPDIK  240
KDGWTEEEDI ILIKAHKEIG NRWAEIARKL PGRTENTIKN HWNATKRRQH SRRTKGKDEI  300
SLSLGSNTLQ NYIRSVTYND DPFMTANANA NIGPRNMRGK GKNVMVAVSE YDEGECKYIV  360
DGVNNLGLED GRIKMPSLAA MSASGSASTS GSASGSGSGV TMEIDEPMTD SWMVMHGCDE  420
VMMNEIALLE MIAHGRL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A3e-441872892104MYB PROTO-ONCOGENE PROTEIN
1mse_C3e-441872892104C-Myb DNA-Binding Domain
1msf_C3e-441872892104C-Myb DNA-Binding Domain
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.80320.0seed
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO153752960.0
Genevisible258233_at0.0
Expression AtlasAT3G27785-
AtGenExpressAT3G27785-
ATTED-IIAT3G27785-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed in embryos from the early heart stage and throughout embryogenesis (PubMed:18695688, PubMed:19066902). Induced at the onset of the maturation phase in the endosperm, in a high and homogeneous repartition (PubMed:18695688, PubMed:19066902, PubMed:25194028, PubMed:27681170). {ECO:0000269|PubMed:18695688, ECO:0000269|PubMed:19066902, ECO:0000269|PubMed:25194028, ECO:0000269|PubMed:27681170}.
UniprotTISSUE SPECIFICITY: Mainly expressed in siliques (PubMed:18695688, PubMed:19066902). Also detected at low levels in leaves and flowers (PubMed:19066902). {ECO:0000269|PubMed:18695688, ECO:0000269|PubMed:19066902}.
Functional Description ? help Back to Top
Source Description
TAIRputative transcription factor (MYB118)
UniProtTranscription activator that recognizes the motif 5'-TAACGG-3' in the promoter of endosperm-induced genes (PubMed:27681170, PubMed:25194028, PubMed:19066902). Promotes vegetative-to-embryonic transition and the formation of somatic embryos from root explants in a WUS-independent manner but via the expression of embryonic genes (e.g. LEC1, LEC2, FUS3 and WUS) (PubMed:18695688). May play an important role during embryogenesis and seed maturation (PubMed:19066902, PubMed:25194028). Together with MYB115, activates the transcription of S-ACP-DES2/AAD2 and S-ACP-DES3/AAD3 thus promoting the biosynthesis of omega-7 monounsaturated fatty acid in seed endosperm (PubMed:27681170). Regulates negatively maturation genes in the endosperm (PubMed:25194028). {ECO:0000269|PubMed:18695688, ECO:0000269|PubMed:19066902, ECO:0000269|PubMed:25194028, ECO:0000269|PubMed:27681170}.
Function -- GeneRIF ? help Back to Top
  1. The Arabidopsis PGA37 gene, encoding the MYB118 transcription factor, induced vegetative-to-embryonic transition, the formation of somatic embryos from root explants, and an elevated LEC1 protein expression level.
    [PMID: 18695688]
  2. AtMYB118 is an important MYB gene involved in embryogenesis.
    [PMID: 19066902]
  3. MYB118 is transcriptionally induced in the maturing endosperm, and seeds of myb118 mutants exhibit an endosperm-specific derepression of maturation-related genes associated with a partial relocation of storage compounds from the embryo to the endosperm.
    [PMID: 25194028]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00385DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G27785.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by LEC2. {ECO:0000269|PubMed:25194028}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT1G21970(A)
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G27785
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ4467080.0DQ446708.1 Arabidopsis thaliana clone pENTR221-At3g27785 myb family transcription factor (At3g27785) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_189416.20.0myb domain protein 118
SwissprotQ9LVW40.0MY118_ARATH; Transcription factor MYB118
TrEMBLA0A178VHH60.0A0A178VHH6_ARATH; PGA37
STRINGAT3G27785.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM60522643
Representative plantOGRP5171784
Publications ? help Back to Top
  1. Wang X, et al.
    Overexpression of PGA37/MYB118 and MYB115 promotes vegetative-to-embryonic transition in Arabidopsis.
    Cell Res., 2009. 19(2): p. 224-35
    [PMID:18695688]
  2. Day RC,Herridge RP,Ambrose BA,Macknight RC
    Transcriptome analysis of proliferating Arabidopsis endosperm reveals biological implications for the control of syncytial division, cytokinin signaling, and gene expression regulation.
    Plant Physiol., 2008. 148(4): p. 1964-84
    [PMID:18923020]
  3. Zhang Y,Cao G,Qu LJ,Gu H
    Involvement of an R2R3-MYB transcription factor gene AtMYB118 in embryogenesis in Arabidopsis.
    Plant Cell Rep., 2009. 28(3): p. 337-46
    [PMID:19066902]
  4. Barthole G, et al.
    MYB118 represses endosperm maturation in seeds of Arabidopsis.
    Plant Cell, 2014. 26(9): p. 3519-37
    [PMID:25194028]
  5. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]
  6. Zhang Y,Li B,Huai D,Zhou Y,Kliebenstein DJ
    The conserved transcription factors, MYB115 and MYB118, control expression of the newly evolved benzoyloxy glucosinolate pathway in Arabidopsis thaliana.
    Front Plant Sci, 2015. 6: p. 343
    [PMID:26029237]
  7. Troncoso-Ponce MA, et al.
    Transcriptional Activation of Two Delta-9 Palmitoyl-ACP Desaturase Genes by MYB115 and MYB118 Is Critical for Biosynthesis of Omega-7 Monounsaturated Fatty Acids in the Endosperm of Arabidopsis Seeds.
    Plant Cell, 2016. 28(10): p. 2666-2682
    [PMID:27681170]
  8. Ettaki H, et al.
    Overexpression of MYB115, AAD2, or AAD3 in Arabidopsis thaliana seeds yields contrasting omega-7 contents.
    PLoS ONE, 2018. 13(1): p. e0192156
    [PMID:29381741]