PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G27650.1
Common NameASL3, LBD25, MGF10.6
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family LBD
Protein Properties Length: 159aa    MW: 17749.4 Da    PI: 9.0107
Description LOB domain-containing protein 25
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G27650.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260140.74.8e-4439137199
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+lrrkC++dCv+apyfp e+p kfanvh++FGasnv+k+l+++ +++reda++sl+yeAear++dPvyG+vg i+ lq+q+ +l+ el++++
  AT3G27650.1  39 PCAACKFLRRKCTSDCVFAPYFPPEEPTKFANVHRIFGASNVSKILHEVAPHQREDAVNSLAYEAEARLKDPVYGCVGAISVLQRQVLRLQRELEETN 136
                  7*********************************************************************************************9987 PP

       DUF260  99 e 99 
                  +
  AT3G27650.1 137 A 137
                  6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.31438139IPR004883Lateral organ boundaries, LOB
PfamPF031951.4E-4339136IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008150Biological Processbiological_process
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000293anatomyguard cell
PO:0009046anatomyflower
PO:0007611developmental stagepetal differentiation and expansion stage
Sequence ? help Back to Top
Protein Sequence    Length: 159 aa     Download sequence    Send to blast
MPKRETKKIK PSQEVIKEGP FLVAIHLKGI YMSNYTNSPC AACKFLRRKC TSDCVFAPYF  60
PPEEPTKFAN VHRIFGASNV SKILHEVAPH QREDAVNSLA YEAEARLKDP VYGCVGAISV  120
LQRQVLRLQR ELEETNADLM RYAGCLGGET TSAYGGRRG
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.272020.0leaf
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO184054710.0
Genevisible258241_at0.0
Expression AtlasAT3G27650-
AtGenExpressAT3G27650-
ATTED-IIAT3G27650-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in young shoots, roots, stems, leaves and flowers. {ECO:0000269|PubMed:12068116}.
Function -- GeneRIF ? help Back to Top
  1. DDA1 (LBD25) functions in both the auxin signalling and photomorphogenesis pathways.
    [PMID: 20797997]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G27650.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G27650
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4738360.0AB473836.1 Arabidopsis thaliana ASL3 mRNA for ASYMMETRIC LEAVES2-like 3 protein, complete cds.
GenBankAB1643040.0AB164304.1 Arabidopsis thaliana ASL3 mRNA for ASYMMETRIC LEAVES2-like gene 3 protein, partial cds.
GenBankAF4478920.0AF447892.1 Arabidopsis thaliana LOB DOMAIN 25 (LBD25) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_566823.11e-117LOB domain-containing protein 25
SwissprotQ8L8Q31e-119LBD25_ARATH; LOB domain-containing protein 25
TrEMBLD7LPI99e-92D7LPI9_ARALL; LOB domain-containing protein 25 (Fragment)
STRINGAT3G27650.11e-116(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6016318
MalvidsOGEM13128340
Publications ? help Back to Top
  1. Iwakawa H, et al.
    The ASYMMETRIC LEAVES2 gene of Arabidopsis thaliana, required for formation of a symmetric flat leaf lamina, encodes a member of a novel family of proteins characterized by cysteine repeats and a leucine zipper.
    Plant Cell Physiol., 2002. 43(5): p. 467-78
    [PMID:12040093]
  2. Shuai B,Reynaga-Peņa CG,Springer PS
    The lateral organ boundaries gene defines a novel, plant-specific gene family.
    Plant Physiol., 2002. 129(2): p. 747-61
    [PMID:12068116]
  3. De Paepe A,Vuylsteke M,Van Hummelen P,Zabeau M,Van Der Straeten D
    Transcriptional profiling by cDNA-AFLP and microarray analysis reveals novel insights into the early response to ethylene in Arabidopsis.
    Plant J., 2004. 39(4): p. 537-59
    [PMID:15272873]
  4. Stracke R, et al.
    Differential regulation of closely related R2R3-MYB transcription factors controls flavonol accumulation in different parts of the Arabidopsis thaliana seedling.
    Plant J., 2007. 50(4): p. 660-77
    [PMID:17419845]
  5. Matsumura Y,Iwakawa H,Machida Y,Machida C
    Characterization of genes in the ASYMMETRIC LEAVES2/LATERAL ORGAN BOUNDARIES (AS2/LOB) family in Arabidopsis thaliana, and functional and molecular comparisons between AS2 and other family members.
    Plant J., 2009. 58(3): p. 525-37
    [PMID:19154202]
  6. Mangeon A,Bell EM,Lin WC,Jablonska B,Springer PS
    Misregulation of the LOB domain gene DDA1 suggests possible functions in auxin signalling and photomorphogenesis.
    J. Exp. Bot., 2011. 62(1): p. 221-33
    [PMID:20797997]