PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G27010.1
Common NameATTCP20, AT-TCP20, MOJ10.8, PCF1, TCP20
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family TCP
Protein Properties Length: 314aa    MW: 33390.9 Da    PI: 7.2565
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G27010.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP124.41.2e-3873154385
          TCP   3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssasns 85 
                  +k+++++++hTkv+gR+RR+R++a+caar+F+L++eLG+++d++ti+WLlqqa+p+i+++tg+++++as+  a+s   s++++
  AT3G27010.1  73 PKRSSNKDRHTKVEGRGRRIRMPALCAARIFQLTRELGHKSDGETIQWLLQQAEPSIIAATGSGTIPASAL-ASSAATSNHHQ 154
                  6999****************************************************************776.23333333322 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036342.4E-3277258IPR005333Transcription factor, TCP
PROSITE profilePS5136928.01678132IPR017887Transcription factor TCP subgroup
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008361Biological Processregulation of cell size
GO:0009653Biological Processanatomical structure morphogenesis
GO:1900056Biological Processnegative regulation of leaf senescence
GO:0005634Cellular Componentnucleus
GO:0000987Molecular Functioncore promoter proximal region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0009005anatomyroot
PO:0009009anatomyplant embryo
PO:0009025anatomyvascular leaf
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MDPKNLNRHQ VPNFLNPPPP PRNQGLVDDD AASAVVSDEN RKPTTEIKDF QIVVSASDKE  60
PNKKSQNQNQ LGPKRSSNKD RHTKVEGRGR RIRMPALCAA RIFQLTRELG HKSDGETIQW  120
LLQQAEPSII AATGSGTIPA SALASSAATS NHHQGGSLTA GLMISHDLDG GSSSSGRPLN  180
WGIGGGEGVS RSSLPTGLWP NVAGFGSGVP TTGLMSEGAG YRIGFPGFDF PGVGHMSFAS  240
ILGGNHNQMP GLELGLSQEG NVGVLNPQSF TQIYQQMGQA QAQAQGRVLH HMHHNHEEHQ  300
QESGEKDDSQ GSGR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.253590.0root
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1865104790.0
Genevisible257788_at0.0
Expression AtlasAT3G27010-
AtGenExpressAT3G27010-
ATTED-IIAT3G27010-
Functional Description ? help Back to Top
Source Description
TAIRBelongs to a TCP protein transcription factor family. Members of this family contain a predicted basic-helix-loop-helix domain involved in DNA binding. Related to rice PCF1 and PCF2 genes. Binds to the GCCCR element of CYCB1;1. Involved in regulation of expression of cell cycle control and ribosomal protein genes.
UniProtTranscription factor that binds to the site II motif (3'-TGGGCC/T-5') in the promoter of PCNA-2 and to 3'-GCCCG/A-5' elements in the promoters of cyclin CYCB1-1 and ribosomal protein genes. {ECO:0000269|PubMed:12631321, ECO:0000269|PubMed:16123132}.
Function -- GeneRIF ? help Back to Top
  1. p33(TCP20), encoded by the Arabidopsis TCP20 gene, binds to the GCCCR element in the promoters of cyclin CYCB1;1
    [PMID: 16123132]
  2. AtTCP20 is involved in cell division and growth coordination.
    [PMID: 19091878]
  3. This study provides evidence for a mechanism whereby the transcriptional regulators SAC51 and TCP20 antagonistically regulate the expression of four subgroup Ib bHLH genes.
    [PMID: 24549883]
  4. TCP20 plays a key role in the systemic signaling pathway that directs nitrate foraging by Arabidopsis roots
    [PMID: 25288754]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00384DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G27010.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Interaction ? help Back to Top
Source Intact With
BioGRIDAT3G47620, AT4G18170, AT4G18390, AT4G27330, AT5G08070, AT5G08330, AT5G51910, AT5G60970, AT1G30210, AT1G35560, AT1G52890, AT1G53230, AT1G58100, AT1G69690
IntActSearch Q9LSD5
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G27010
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0026860.0CP002686.1 Arabidopsis thaliana chromosome 3, complete sequence.
GenBankBT0060430.0BT006043.1 Arabidopsis thaliana clone U50934 unknown protein (At3g27010) mRNA, complete cds.
GenBankAB0266490.0AB026649.1 Arabidopsis thaliana genomic DNA, chromosome 3, P1 clone: MOJ10.
GenBankAK1181780.0AK118178.1 Arabidopsis thaliana At3g27010 mRNA for unknown protein, complete cds, clone: RAFL19-49-P20.
GenBankAJ2917490.0AJ291749.1 Arabidopsis thaliana mRNA for putative transcription factor (PCF1 gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_189337.10.0transcription factor TCP20
SwissprotQ9LSD50.0TCP20_ARATH; Transcription factor TCP20
TrEMBLD7LRC31e-179D7LRC3_ARALL; Putative uncharacterized protein
STRINGAT3G27010.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9221459
MalvidsOGEM40502759
Publications ? help Back to Top
  1. Cubas P,Lauter N,Doebley J,Coen E
    The TCP domain: a motif found in proteins regulating plant growth and development.
    Plant J., 1999. 18(2): p. 215-22
    [PMID:10363373]
  2. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  3. Seki M, et al.
    Functional annotation of a full-length Arabidopsis cDNA collection.
    Science, 2002. 296(5565): p. 141-5
    [PMID:11910074]
  4. Kosugi S,Ohashi Y
    DNA binding and dimerization specificity and potential targets for the TCP protein family.
    Plant J., 2002. 30(3): p. 337-48
    [PMID:12000681]
  5. Trémousaygue D, et al.
    Internal telomeric repeats and 'TCP domain' protein-binding sites co-operate to regulate gene expression in Arabidopsis thaliana cycling cells.
    Plant J., 2003. 33(6): p. 957-66
    [PMID:12631321]
  6. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  7. Li C,Potuschak T,Colón-Carmona A,Gutiérrez RA,Doerner P
    Arabidopsis TCP20 links regulation of growth and cell division control pathways.
    Proc. Natl. Acad. Sci. U.S.A., 2005. 102(36): p. 12978-83
    [PMID:16123132]
  8. Vergnolle C, et al.
    The cold-induced early activation of phospholipase C and D pathways determines the response of two distinct clusters of genes in Arabidopsis cell suspensions.
    Plant Physiol., 2005. 139(3): p. 1217-33
    [PMID:16258011]
  9. Andersson-Gunner
    Biosynthesis of cellulose-enriched tension wood in Populus: global analysis of transcripts and metabolites identifies biochemical and developmental regulators in secondary wall biosynthesis.
    Plant J., 2006. 45(2): p. 144-65
    [PMID:16367961]
  10. Aguilar-Martínez JA,Poza-Carrión C,Cubas P
    Arabidopsis BRANCHED1 acts as an integrator of branching signals within axillary buds.
    Plant Cell, 2007. 19(2): p. 458-72
    [PMID:17307924]
  11. Ascencio-Ib
    Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection.
    Plant Physiol., 2008. 148(1): p. 436-54
    [PMID:18650403]
  12. Hervé C, et al.
    In vivo interference with AtTCP20 function induces severe plant growth alterations and deregulates the expression of many genes important for development.
    Plant Physiol., 2009. 149(3): p. 1462-77
    [PMID:19091878]
  13. Viola IL,Uberti Manassero NG,Ripoll R,Gonzalez DH
    The Arabidopsis class I TCP transcription factor AtTCP11 is a developmental regulator with distinct DNA-binding properties due to the presence of a threonine residue at position 15 of the TCP domain.
    Biochem. J., 2011. 435(1): p. 143-55
    [PMID:21241251]
  14. Viola IL,Reinheimer R,Ripoll R,Manassero NG,Gonzalez DH
    Determinants of the DNA binding specificity of class I and class II TCP transcription factors.
    J. Biol. Chem., 2012. 287(1): p. 347-56
    [PMID:22074922]
  15. Danisman S, et al.
    Arabidopsis class I and class II TCP transcription factors regulate jasmonic acid metabolism and leaf development antagonistically.
    Plant Physiol., 2012. 159(4): p. 1511-23
    [PMID:22718775]
  16. Efroni I, et al.
    Regulation of leaf maturation by chromatin-mediated modulation of cytokinin responses.
    Dev. Cell, 2013. 24(4): p. 438-45
    [PMID:23449474]
  17. Danisman S, et al.
    Analysis of functional redundancies within the Arabidopsis TCP transcription factor family.
    J. Exp. Bot., 2013. 64(18): p. 5673-85
    [PMID:24129704]
  18. Andriankaja ME, et al.
    Transcriptional coordination between leaf cell differentiation and chloroplast development established by TCP20 and the subgroup Ib bHLH transcription factors.
    Plant Mol. Biol., 2014. 85(3): p. 233-45
    [PMID:24549883]
  19. Kim SH, et al.
    The Arabidopsis immune adaptor SRFR1 interacts with TCP transcription factors that redundantly contribute to effector-triggered immunity.
    Plant J., 2014. 78(6): p. 978-89
    [PMID:24689742]
  20. Davi
    Class I TCP-DELLA interactions in inflorescence shoot apex determine plant height.
    Curr. Biol., 2014. 24(16): p. 1923-8
    [PMID:25127215]
  21. We
    Convergent targeting of a common host protein-network by pathogen effectors from three kingdoms of life.
    Cell Host Microbe, 2014. 16(3): p. 364-75
    [PMID:25211078]
  22. Guan P, et al.
    Nitrate foraging by Arabidopsis roots is mediated by the transcription factor TCP20 through the systemic signaling pathway.
    Proc. Natl. Acad. Sci. U.S.A., 2014. 111(42): p. 15267-72
    [PMID:25288754]
  23. Chen GH,Sun JY,Liu M,Liu J,Yang WC
    SPOROCYTELESS is a novel embryophyte-specific transcription repressor that interacts with TPL and TCP proteins in Arabidopsis.
    J Genet Genomics, 2014. 41(12): p. 617-25
    [PMID:25527103]
  24. Wang X, et al.
    TCP transcription factors are critical for the coordinated regulation of isochorismate synthase 1 expression in Arabidopsis thaliana.
    Plant J., 2015. 82(1): p. 151-62
    [PMID:25702611]
  25. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]
  26. Kosugi S,Ohashi Y
    PCF1 and PCF2 specifically bind to cis elements in the rice proliferating cell nuclear antigen gene.
    Plant Cell, 1997. 9(9): p. 1607-19
    [PMID:9338963]