PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G26660.1
Common NameASL13, LBD24, MLJ15.5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family LBD
Protein Properties Length: 121aa    MW: 13683.8 Da    PI: 8.7582
Description LOB domain-containing protein 24
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G26660.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260132.91.3e-4151051101
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+lrr+C+kdCv++pyfp ++p+kfa+vh+++Ga nv+k+l++lp+++r +a++sl++eA++r++dPvyG+vg+i+ l+ q++++++ela+++
  AT3G26660.1   5 RCAACKYLRRRCPKDCVFSPYFPPNDPQKFACVHRIYGAGNVSKMLQQLPDQTRAEAVESLCFEAKCRVDDPVYGCVGIIHLLKTQIQKTQNELAKTQ 102
                  6***********************************************************************************************99 PP

       DUF260  99 eel 101
                  +e+
  AT3G26660.1 103 AEI 105
                  875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.4724105IPR004883Lateral organ boundaries, LOB
PfamPF031958.1E-415102IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008150Biological Processbiological_process
GO:0016020Cellular Componentmembrane
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009025anatomyvascular leaf
Sequence ? help Back to Top
Protein Sequence    Length: 121 aa     Download sequence    Send to blast
MNPKRCAACK YLRRRCPKDC VFSPYFPPND PQKFACVHRI YGAGNVSKML QQLPDQTRAE  60
AVESLCFEAK CRVDDPVYGC VGIIHLLKTQ IQKTQNELAK TQAEIAVAQT KLSQTQNSDF  120
M
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO2402554380.0
Genevisible257548_s_at0.0
Expression AtlasAT3G26660-
AtGenExpressAT3G26660-
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G26660.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G26660
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4738460.0AB473846.1 Arabidopsis thaliana ASL13 mRNA for ASYMMETRIC LEAVES2-like 13 protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_189300.14e-87LOB domain-containing protein 24
SwissprotP594685e-89LBD24_ARATH; LOB domain-containing protein 24
TrEMBLR0FT524e-81R0FT52_9BRAS; Uncharacterized protein
STRINGAT3G26660.11e-86(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6016318
MalvidsOGEM13128340
Publications ? help Back to Top
  1. Iwakawa H, et al.
    The ASYMMETRIC LEAVES2 gene of Arabidopsis thaliana, required for formation of a symmetric flat leaf lamina, encodes a member of a novel family of proteins characterized by cysteine repeats and a leucine zipper.
    Plant Cell Physiol., 2002. 43(5): p. 467-78
    [PMID:12040093]
  2. Shuai B,Reynaga-Peña CG,Springer PS
    The lateral organ boundaries gene defines a novel, plant-specific gene family.
    Plant Physiol., 2002. 129(2): p. 747-61
    [PMID:12068116]
  3. Mitra SK,Gantt JA,Ruby JF,Clouse SD,Goshe MB
    Membrane proteomic analysis of Arabidopsis thaliana using alternative solubilization techniques.
    J. Proteome Res., 2007. 6(5): p. 1933-50
    [PMID:17432890]
  4. Matsumura Y,Iwakawa H,Machida Y,Machida C
    Characterization of genes in the ASYMMETRIC LEAVES2/LATERAL ORGAN BOUNDARIES (AS2/LOB) family in Arabidopsis thaliana, and functional and molecular comparisons between AS2 and other family members.
    Plant J., 2009. 58(3): p. 525-37
    [PMID:19154202]
  5. Quigley F,Dao P,Cottet A,Mache R
    Sequence analysis of an 81 kb contig from Arabidopsis thaliana chromosome III.
    Nucleic Acids Res., 1996. 24(21): p. 4313-8
    [PMID:8932388]