PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G25790.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family G2-like
Protein Properties Length: 357aa    MW: 40369.9 Da    PI: 7.7532
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G25790.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.51.1e-31196251156
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                  k+r++W++eLH+rF++a++qLGG+++AtPk+i+++mkv+gLt+++vkSHLQkYRl+
  AT3G25790.1 196 KNRRCWSQELHRRFLNALKQLGGPHVATPKQIRDIMKVDGLTNDEVKSHLQKYRLH 251
                  68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.235193253IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.5E-27194254IPR009057Homeodomain-like
SuperFamilySSF466894.93E-17194253IPR009057Homeodomain-like
TIGRFAMsTIGR015574.8E-27196251IPR006447Myb domain, plants
PfamPF002491.5E-6198249IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009005anatomyroot
PO:0020100anatomyhypocotyl
Sequence ? help Back to Top
Protein Sequence    Length: 357 aa     Download sequence    Send to blast
MIKNLSNMKN DNQKREKCCE YIEALEEERR KINVFQRELP LCVELVTQAI EAYKREISGT  60
STDNLYGQSE CSEQTTGECG RILDLFIPIK HSSTSIEEEV DDKDDDDEEH QSHETDIDFD  120
DKNMKSEWLK SVQLWNQSDA VVSNNRQDRS QEKTETLVEL IKINDEAAKK NNNIKSPVTT  180
SDGGSGGGGG RRGQRKNRRC WSQELHRRFL NALKQLGGPH VATPKQIRDI MKVDGLTNDE  240
VKSHLQKYRL HARRPSQTTP NNRNSQTQHF VVVGGIWVPQ TNHSTANAVN AVASGETTGI  300
YGPMVSSLPS EWPRHSNFGR KISEDRSRCS NNGFFRCSSP AMSCSTRTKT KDAKIIS
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible257645_at0.0
Expression AtlasAT3G25790-
AtGenExpressAT3G25790-
ATTED-IIAT3G25790-
Functional Description ? help Back to Top
Source Description
UniProtProbable factor involved in nitrate and phosphate signaling in roots. Integrates nitrate and phosphate starvation responses and adaptation of root architecture, depending on nutrient availabilities. Acts downstream of the nitrate sensor and transporter NPF6.3/NRT1.1. Represses primary root development in response to phosphate deficiency conditions, only when nitrate is present. {ECO:0000269|PubMed:25723764}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G25790.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by nitrate (PubMed:25723764). Down-regulated under nitrate deprivation conditions (PubMed:27419465). {ECO:0000269|PubMed:25723764, ECO:0000269|PubMed:27419465}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G25790
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0855700.0AY085570.1 Arabidopsis thaliana clone 157740 mRNA, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_566778.10.0myb-like transcription factor family protein
SwissprotQ9LS000.0HHO1_ARATH; Transcription factor HHO1
TrEMBLA0A178V8360.0A0A178V836_ARATH; Uncharacterized protein
STRINGAT3G25790.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM136001827
Representative plantOGRP54151221
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Czechowski T,Bari RP,Stitt M,Scheible WR,Udvardi MK
    Real-time RT-PCR profiling of over 1400 Arabidopsis transcription factors: unprecedented sensitivity reveals novel root- and shoot-specific genes.
    Plant J., 2004. 38(2): p. 366-79
    [PMID:15078338]
  3. Scheible WR, et al.
    Genome-wide reprogramming of primary and secondary metabolism, protein synthesis, cellular growth processes, and the regulatory infrastructure of Arabidopsis in response to nitrogen.
    Plant Physiol., 2004. 136(1): p. 2483-99
    [PMID:15375205]
  4. Ma S,Quist TM,Ulanov A,Joly R,Bohnert HJ
    Loss of TIP1;1 aquaporin in Arabidopsis leads to cell and plant death.
    Plant J., 2004. 40(6): p. 845-59
    [PMID:15584951]
  5. Lee DJ, et al.
    Genome-wide expression profiling of ARABIDOPSIS RESPONSE REGULATOR 7(ARR7) overexpression in cytokinin response.
    Mol. Genet. Genomics, 2007. 277(2): p. 115-37
    [PMID:17061125]
  6. Rajagopalan R,Vaucheret H,Trejo J,Bartel DP
    A diverse and evolutionarily fluid set of microRNAs in Arabidopsis thaliana.
    Genes Dev., 2006. 20(24): p. 3407-25
    [PMID:17182867]
  7. Menz J,Li Z,Schulze WX,Ludewig U
    Early nitrogen-deprivation responses in Arabidopsis roots reveal distinct differences on transcriptome and (phospho-) proteome levels between nitrate and ammonium nutrition.
    Plant J., 2016. 88(5): p. 717-734
    [PMID:27419465]