PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G24120.1
Common NameMUJ8.3, PHL2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family G2-like
Protein Properties Length: 295aa    MW: 32205.3 Da    PI: 7.1807
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G24120.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like107.66.9e-344195155
      G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                 kprlrWt+eLHerFv+av+qLGG++kAtPkti+++m+vkgLtl+h+kSHLQk+Rl
  AT3G24120.1 41 KPRLRWTTELHERFVDAVTQLGGPDKATPKTIMRTMGVKGLTLYHLKSHLQKFRL 95
                 79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.6463898IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.8E-323896IPR009057Homeodomain-like
SuperFamilySSF466895.91E-174096IPR009057Homeodomain-like
TIGRFAMsTIGR015576.0E-244196IPR006447Myb domain, plants
PfamPF002496.0E-84393IPR001005SANT/Myb domain
PfamPF143791.7E-26139185IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010628Biological Processpositive regulation of gene expression
GO:0016036Biological Processcellular response to phosphate starvation
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025195anatomypollen tube cell
PO:0025281anatomypollen
PO:0001016developmental stageL mature pollen stage
PO:0001017developmental stageM germinated pollen stage
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
MYSAIRSLPL DGGHVGGDYH GPLDGTNLPG DACLVLTTDP KPRLRWTTEL HERFVDAVTQ  60
LGGPDKATPK TIMRTMGVKG LTLYHLKSHL QKFRLGRQAG KESTENSKDA SCVGESQDTG  120
SSSTSSMRMA QQEQNEGYQV TEALRAQMEV QRRLHDQLEV QRRLQLRIEA QGKYLQSILE  180
KACKAFDEQA ATFAGLEAAR EELSELAIKV SNSSQGTSVP YFDATKMMMM PSLSELAVAI  240
DNKNNITTNC SVESSLTSIT HGSSISAASM KKRQRGDNLG VGYESGWIMP SSTIG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A6e-194197157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B6e-194197157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C6e-194197157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D6e-194197157Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.265880.0flower| silique
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible257250_at0.0
Expression AtlasAT3G24120-
AtGenExpressAT3G24120-
ATTED-IIAT3G24120-
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator (PubMed:26586833). Acts redundantly with PHR1 as a key component of the central regulatory system controlling transcriptional responses to Pi starvation (PubMed:26586833). Binds in a sequence-specific manner to phosphate starvation-regulated promoters (PubMed:26586833). {ECO:0000269|PubMed:26586833}.
Function -- GeneRIF ? help Back to Top
  1. PHL2 and PHR1 act redundantly as the key components of the central regulatory system controlling transcriptional responses to phosphate starvation.
    [PMID: 26586833]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00378DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G24120.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated in roots by low Pi. {ECO:0000269|PubMed:26586833}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Interaction ? help Back to Top
Source Intact With
BioGRIDAT4G13640
IntActSearch Q94A57
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G24120
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0503550.0AY050355.1 Arabidopsis thaliana AT3g24120/MUJ8_3 mRNA, complete cds.
GenBankAY0884280.0AY088428.1 Arabidopsis thaliana clone 6626 mRNA, complete sequence.
GenBankAY0940460.0AY094046.1 Arabidopsis thaliana AT3g24120/MUJ8_3 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_566744.10.0Homeodomain-like superfamily protein
SwissprotQ94A570.0PHL2_ARATH; Protein PHR1-LIKE 2
TrEMBLA0A178VFD10.0A0A178VFD1_ARATH; Uncharacterized protein
STRINGAT3G24120.20.0(Arabidopsis thaliana)
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Rubio V, et al.
    A conserved MYB transcription factor involved in phosphate starvation signaling both in vascular plants and in unicellular algae.
    Genes Dev., 2001. 15(16): p. 2122-33
    [PMID:11511543]
  3. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  4. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  5. Ascencio-Ib
    Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection.
    Plant Physiol., 2008. 148(1): p. 436-54
    [PMID:18650403]
  6. Wang Y, et al.
    Transcriptome analyses show changes in gene expression to accompany pollen germination and tube growth in Arabidopsis.
    Plant Physiol., 2008. 148(3): p. 1201-11
    [PMID:18775970]
  7. Arabidopsis Interactome Mapping Consortium
    Evidence for network evolution in an Arabidopsis interactome map.
    Science, 2011. 333(6042): p. 601-7
    [PMID:21798944]
  8. Klopffleisch K, et al.
    Arabidopsis G-protein interactome reveals connections to cell wall carbohydrates and morphogenesis.
    Mol. Syst. Biol., 2011. 7: p. 532
    [PMID:21952135]
  9. Zhao C,Beers E
    Alternative splicing of Myb-related genes MYR1 and MYR2 may modulate activities through changes in dimerization, localization, or protein folding.
    Plant Signal Behav, 2013. 8(11): p. e27325
    [PMID:24309816]
  10. Sun L,Song L,Zhang Y,Zheng Z,Liu D
    Arabidopsis PHL2 and PHR1 Act Redundantly as the Key Components of the Central Regulatory System Controlling Transcriptional Responses to Phosphate Starvation.
    Plant Physiol., 2016. 170(1): p. 499-514
    [PMID:26586833]