PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G24050.1
Common NameF14O13.24, GATA1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family GATA
Protein Properties Length: 274aa    MW: 30113.7 Da    PI: 7.4373
Description GATA transcription factor 1
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G24050.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA61.31.2e-19196230135
         GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                  C++Cg+ kTp+WR gp g+ktLCnaCG++y++ +l
  AT3G24050.1 196 CQHCGAEKTPQWRAGPAGPKTLCNACGVRYKSGRL 230
                  *******************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004018.8E-15190240IPR000679Zinc finger, GATA-type
SuperFamilySSF577168.08E-15193253No hitNo description
PROSITE profilePS5011412.07193226IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.102.9E-15194228IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.41E-14195242No hitNo description
PfamPF003203.0E-17196230IPR000679Zinc finger, GATA-type
PROSITE patternPS003440196221IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0030154Biological Processcell differentiation
GO:0045944Biological Processpositive regulation of transcription from RNA polymerase II promoter
GO:0005634Cellular Componentnucleus
GO:0005667Cellular Componenttranscription factor complex
GO:0000977Molecular FunctionRNA polymerase II regulatory region sequence-specific DNA binding
GO:0001085Molecular FunctionRNA polymerase II transcription factor binding
GO:0001228Molecular Functiontranscriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding
GO:0003682Molecular Functionchromatin binding
GO:0008270Molecular Functionzinc ion binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000084anatomyplant sperm cell
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 274 aa     Download sequence    Send to blast
MEMESFMDDL LNFSVPEEEE DDDEHTQPPR NITRRKTGLR PTDSFGLFNT DDLGVVEEED  60
LEWISNKNAF PVIETFVGVL PSEHFPITSL LEREATEVKQ LSPVSVLETS SHSSTTTTSN  120
SSGGSNGSTA VATTTTTPTI MSCCVGFKAP AKARSKRRRT GRRDLRVLWT GNEQGGIQKK  180
KTMTVAAAAL IMGRKCQHCG AEKTPQWRAG PAGPKTLCNA CGVRYKSGRL VPEYRPANSP  240
TFTAELHSNS HRKIVEMRKQ YQSGDGDGDR KDCG
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.243700.0cell culture| flower| leaf| root
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1453388840.0
Genevisible256916_at0.0
Expression AtlasAT3G24050-
AtGenExpressAT3G24050-
ATTED-IIAT3G24050-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Mostly expressed in roots. Also expressed in stems, flowers and leaves. {ECO:0000269|PubMed:12139008}.
Functional Description ? help Back to Top
Source Description
TAIREncodes a member of the GATA factor family of zinc finger transcription factors.
UniProtTranscriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes. {ECO:0000269|PubMed:12139008}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00377DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G24050.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G24050
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0244970.0BT024497.1 Arabidopsis thaliana At3g24050 mRNA, complete cds.
GenBankY136480.0Y13648.1 Arabidopsis thaliana mRNA for GATA transcription factor 1.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_189047.10.0GATA transcription factor 1
SwissprotQ8LAU90.0GATA1_ARATH; GATA transcription factor 1
TrEMBLA0A384KMY50.0A0A384KMY5_ARATH; GATA1
TrEMBLQ2HIT40.0Q2HIT4_ARATH; At3g24050
STRINGAT3G24050.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM129872430
Representative plantOGRP6817287
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Teakle GR,Manfield IW,Graham JF,Gilmartin PM
    Arabidopsis thaliana GATA factors: organisation, expression and DNA-binding characteristics.
    Plant Mol. Biol., 2002. 50(1): p. 43-57
    [PMID:12139008]
  3. Jeong MJ,Jeong MJ,Shih MC
    Interaction of a GATA factor with cis-acting elements involved in light regulation of nuclear genes encoding chloroplast glyceraldehyde-3-phosphate dehydrogenase in Arabidopsis.
    Biochem. Biophys. Res. Commun., 2003. 300(2): p. 555-62
    [PMID:12504119]
  4. Zik M,Irish VF
    Global identification of target genes regulated by APETALA3 and PISTILLATA floral homeotic gene action.
    Plant Cell, 2003. 15(1): p. 207-22
    [PMID:12509532]
  5. Mart
    Genomic analysis of the unfolded protein response in Arabidopsis shows its connection to important cellular processes.
    Plant Cell, 2003. 15(2): p. 561-76
    [PMID:12566592]
  6. Hu W,Wang Y,Bowers C,Ma H
    Isolation, sequence analysis, and expression studies of florally expressed cDNAs in Arabidopsis.
    Plant Mol. Biol., 2003. 53(4): p. 545-63
    [PMID:15010618]
  7. Reyes JC,Muro-Pastor MI,Florencio FJ
    The GATA family of transcription factors in Arabidopsis and rice.
    Plant Physiol., 2004. 134(4): p. 1718-32
    [PMID:15084732]
  8. Bi YM, et al.
    Genetic analysis of Arabidopsis GATA transcription factor gene family reveals a nitrate-inducible member important for chlorophyll synthesis and glucose sensitivity.
    Plant J., 2005. 44(4): p. 680-92
    [PMID:16262716]
  9. Manfield IW,Devlin PF,Jen CH,Westhead DR,Gilmartin PM
    Conservation, convergence, and divergence of light-responsive, circadian-regulated, and tissue-specific expression patterns during evolution of the Arabidopsis GATA gene family.
    Plant Physiol., 2007. 143(2): p. 941-58
    [PMID:17208962]
  10. Chiang YH, et al.
    Functional characterization of the GATA transcription factors GNC and CGA1 reveals their key role in chloroplast development, growth, and division in Arabidopsis.
    Plant Physiol., 2012. 160(1): p. 332-48
    [PMID:22811435]