PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G22780.1
Common NameATTSO1, MWI23.15, TSO1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family CPP
Protein Properties Length: 695aa    MW: 76276.8 Da    PI: 6.675
Description Tesmin/TSO1-like CXC domain-containing protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G22780.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR50.54e-16399437240
          TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                  ++k+CnCkkskClk+YCeCfaag++C e C+C dC+Nk 
  AT3G22780.1 399 SCKRCNCKKSKCLKLYCECFAAGVYCIEPCSCIDCFNKP 437
                  689**********************************96 PP

2TCR49.77.4e-16484522139
          TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                  ++k+gCnCkks+C+kkYCeC++ g+ Cs +C+Ce+C N 
  AT3G22780.1 484 RHKRGCNCKKSNCMKKYCECYQGGVGCSMNCRCEGCTNV 522
                  589**********************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011142.3E-19398439IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163436.989399524IPR005172CRC domain
PfamPF036386.7E-12401436IPR005172CRC domain
SMARTSM011145.6E-16484525IPR033467Tesmin/TSO1-like CXC domain
PfamPF036387.0E-11486521IPR005172CRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009934Biological Processregulation of meristem structural organization
GO:0048444Biological Processfloral organ morphogenesis
GO:0051302Biological Processregulation of cell division
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046872Molecular Functionmetal ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 695 aa     Download sequence    Send to blast
MDKSQKNPTS QIGTSTPKSK FEDSPVFNYI SNLSPIESVK SISTAQTFSS LSFTSPPPVF  60
TSPHVISHRE SRFFRCHNSV DRSKHLESLD GSAVKGEVVV PLVEDLNKEA SLEDEEETSV  120
ETSSELPQIM KFDSQTSEHS DSPCTEDVVI EASSDPPRGD NGSSSEDVTM GLQNMLVVRE  180
GNDTPGCGRL ISDATELLVF RSPNDSEAFR CLVDKISSSE RRFCAGVKST KRPDINKDIP  240
ANGSSNENQP LAVLPTNESV FNLHRGGMRR RCLDFEMPGK RKKDIVDDQQ SVCDNNVAGE  300
SSSSCVVPGI GLHLNAVAMS AKDSNISVIH GYSISGEIQK SFSGSTTPIQ SQDTVQETSD  360
QAENEPVEEV PKALVFPELN LGSLKKKMRK SEQAGEGESC KRCNCKKSKC LKLYCECFAA  420
GVYCIEPCSC IDCFNKPIHE ETVLATRKQI ESRNPLAFAP KVIRNADSIM EASDDASKTP  480
ASARHKRGCN CKKSNCMKKY CECYQGGVGC SMNCRCEGCT NVFGRKDGSL LVIMESKLEE  540
NQETYEKRIA KIQHNVEVSK EVEQNPSSDQ PSTPLPPYRH LVVHQPFLSK NRLPPTQFFL  600
GTGSSSFRKP NSDLAQSQNE KKPLETVTED KTEIMPEILL NSPIANIKAI SPNSKRVSPP  660
QPGSSESGSI LRRRGNGRKL ILRSIPAFPS LNPNQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A1e-1540352214121Protein lin-54 homolog
5fd3_B1e-1540352214121Protein lin-54 homolog
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1268282RRRCLDFEMPGKRKK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.249530.0flower| leaf| root| silique
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO67398200.0
Genevisible258324_at0.0
Expression AtlasAT3G22780-
AtGenExpressAT3G22780-
ATTED-IIAT3G22780-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed at the first stage of pollen development in uninucleate microspores and bicellular pollen but not in tricellular and mature pollen. {ECO:0000269|PubMed:18057042}.
UniprotTISSUE SPECIFICITY: Ubiquitous but expressed mostly in flowers with highest levels in developing ovules and microspores. {ECO:0000269|PubMed:10769244, ECO:0000269|PubMed:10769245, ECO:0000269|PubMed:18057042}.
Functional Description ? help Back to Top
Source Description
TAIRputative DNA binding protein (tso1) mRNA, tso1-3 allele,
UniProtProbable floral-specific cell division component, required for proper organ formation in flowers. Regulates the floral meristem cell division and the inflorescence meristem organization. Plays a role in development of both male and female reproductive tissues. {ECO:0000269|PubMed:10769244, ECO:0000269|PubMed:10769245, ECO:0000269|PubMed:9043081, ECO:0000269|PubMed:9725857}.
Function -- GeneRIF ? help Back to Top
  1. The roles of TCX proteins in the observed range of phenotypes in tso1 mutants in A. thaliana are reported.
    [PMID: 18057042]
  2. the class I phenotype can be mimicked by knocking out both TSO1 and its homolog SOL2 in double mutants.
    [PMID: 22072982]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00370DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G22780.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Disruption Phenotype ? help Back to Top
Source Description
UniProtDISRUPTION PHENOTYPE: Despite a wild-type flower phenotype, the null mutant presents defects in pollen, carpel and ovule development, including a failure in megasporogenesis. Small siliques. {ECO:0000269|PubMed:18057042, ECO:0000269|PubMed:22072982, ECO:0000269|PubMed:9725857}.
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G22780
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF2040590.0AF204059.1 Arabidopsis thaliana CXC domain protein TSO1 (TSO1) mRNA, complete cds.
GenBankAF2063240.0AF206324.1 Arabidopsis thaliana putative DNA binding protein (tso1) mRNA, tso1-3 allele, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_566718.20.0Tesmin/TSO1-like CXC domain-containing protein
SwissprotQ9LUI30.0TSO1_ARATH; CRC domain-containing protein TSO1
TrEMBLA0A178VBV10.0A0A178VBV1_ARATH; TSO1
STRINGAT3G22780.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14672891
Representative plantOGRP9931755
Publications ? help Back to Top
  1. Song JY,Leung T,Ehler LK,Wang C,Liu Z
    Regulation of meristem organization and cell division by TSO1, an Arabidopsis gene with cysteine-rich repeats.
    Development, 2000. 127(10): p. 2207-17
    [PMID:10769244]
  2. Hauser BA,He JQ,Park SO,Gasser CS
    TSO1 is a novel protein that modulates cytokinesis and cell expansion in Arabidopsis.
    Development, 2000. 127(10): p. 2219-26
    [PMID:10769245]
  3. Broadhvest J,Baker SC,Gasser CS
    SHORT INTEGUMENTS 2 promotes growth during Arabidopsis reproductive development.
    Genetics, 2000. 155(2): p. 899-907
    [PMID:10835408]
  4. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  5. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  6. Andersen SU, et al.
    The conserved cysteine-rich domain of a tesmin/TSO1-like protein binds zinc in vitro and TSO1 is required for both male and female fertility in Arabidopsis thaliana.
    J. Exp. Bot., 2007. 58(13): p. 3657-70
    [PMID:18057042]
  7. Sijacic P,Wang W,Liu Z
    Recessive antimorphic alleles overcome functionally redundant loci to reveal TSO1 function in Arabidopsis flowers and meristems.
    PLoS Genet., 2011. 7(11): p. e1002352
    [PMID:22072982]
  8. Lu T,Dou Y,Zhang C
    Fuzzy clustering of CPP family in plants with evolution and interaction analyses.
    BMC Bioinformatics, 2013. 14 Suppl 13: p. S10
    [PMID:24268301]
  9. Xie W, et al.
    Exploring potential new floral organ morphogenesis genes of Arabidopsis thaliana using systems biology approach.
    Front Plant Sci, 2015. 6: p. 829
    [PMID:26528302]
  10. Wang W,Sijacic P,Xu P,Lian H,Liu Z
    Arabidopsis TSO1 and MYB3R1 form a regulatory module to coordinate cell proliferation with differentiation in shoot and root.
    Proc. Natl. Acad. Sci. U.S.A., 2018. 115(13): p. E3045-E3054
    [PMID:29535223]
  11. Liu Z,Running MP,Meyerowitz EM
    TSO1 functions in cell division during Arabidopsis flower development.
    Development, 1997. 124(3): p. 665-72
    [PMID:9043081]
  12. Hauser BA,Villanueva JM,Gasser CS
    Arabidopsis TSO1 regulates directional processes in cells during floral organogenesis.
    Genetics, 1998. 150(1): p. 411-23
    [PMID:9725857]