PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G21270.1
Common NameADOF2, DOF2, DOF3.1, MXL8.14
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family Dof
Protein Properties Length: 204aa    MW: 22530 Da    PI: 9.5985
Description DOF zinc finger protein 2
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G21270.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof126.39.2e-402584261
       zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                 ++++lkcprCds ntkfCyynny+lsqPr+fCk+CrryWtkGGalrnvPvGgg+rkn ++
  AT3G21270.1 25 EQEQLKCPRCDSPNTKFCYYNNYNLSQPRHFCKSCRRYWTKGGALRNVPVGGGSRKNATK 84
                 5789****************************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027011.9E-332783IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.2552983IPR003851Zinc finger, Dof-type
ProDomPD0074783.0E-232977IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103167IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
GO:0046872Molecular Functionmetal ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000084anatomyplant sperm cell
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025195anatomypollen tube cell
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 204 aa     Download sequence    Send to blast
MQDPAAYYQT MMAKQQQQQQ PQFAEQEQLK CPRCDSPNTK FCYYNNYNLS QPRHFCKSCR  60
RYWTKGGALR NVPVGGGSRK NATKRSTSSS SSASSPSNSS QNKKTKNPDP DPDPRNSQKP  120
DLDPTRMLYG FPIGDQDVKG MEIGGSFSSL LANNMQLGLG GGGIMLDGSG WDHPGMGLGL  180
RRTEPGNNNN NPWTDLAMNR AEKN
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.2570.0flower| inflorescence
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible258044_at0.0
Expression AtlasAT3G21270-
AtGenExpressAT3G21270-
ATTED-IIAT3G21270-
Functional Description ? help Back to Top
Source Description
TAIREncodes Dof zinc finger protein adof2.
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G21270.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G21270
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0175650.0AB017565.1 Arabidopsis thaliana adof2 mRNA for Dof zinc finger protein, complete cds.
GenBankAB0230450.0AB023045.1 Arabidopsis thaliana genomic DNA, chromosome 3, P1 clone: MXL8.
GenBankAY1503910.0AY150391.1 Arabidopsis thaliana Dof zinc finger protein (At3g21270) mRNA, complete cds.
GenBankCP0026860.0CP002686.1 Arabidopsis thaliana chromosome 3, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_188764.11e-151DOF zinc finger protein 2
SwissprotQ94AR61e-152DOF31_ARATH; Dof zinc finger protein DOF3.1
TrEMBLA0A178VA071e-149A0A178VA07_ARATH; DOF2
STRINGAT3G21270.11e-150(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM12692896
Representative plantOGRP3817445
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Yanagisawa S
    The Dof family of plant transcription factors.
    Trends Plant Sci., 2002. 7(12): p. 555-60
    [PMID:12475498]
  3. Park DH, et al.
    The Arabidopsis COG1 gene encodes a Dof domain transcription factor and negatively regulates phytochrome signaling.
    Plant J., 2003. 34(2): p. 161-71
    [PMID:12694592]
  4. Lijavetzky D,Carbonero P,Vicente-Carbajosa J
    Genome-wide comparative phylogenetic analysis of the rice and Arabidopsis Dof gene families.
    BMC Evol. Biol., 2003. 3: p. 17
    [PMID:12877745]
  5. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  6. Wang XJ,Cao XL,Hong Y
    Isolation and characterization of flower-specific transcripts in Acacia mangium.
    Tree Physiol., 2005. 25(2): p. 167-78
    [PMID:15574398]
  7. Penfield S,Graham S,Graham IA
    Storage reserve mobilization in germinating oilseeds: Arabidopsis as a model system.
    Biochem. Soc. Trans., 2005. 33(Pt 2): p. 380-3
    [PMID:15787611]
  8. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  9. Wang Y, et al.
    Transcriptome analyses show changes in gene expression to accompany pollen germination and tube growth in Arabidopsis.
    Plant Physiol., 2008. 148(3): p. 1201-11
    [PMID:18775970]
  10. Gardiner J,Sherr I,Scarpella E
    Expression of DOF genes identifies early stages of vascular development in Arabidopsis leaves.
    Int. J. Dev. Biol., 2010. 54(8-9): p. 1389-96
    [PMID:20563990]
  11. Gaudinier A, et al.
    Enhanced Y1H assays for Arabidopsis.
    Nat. Methods, 2011. 8(12): p. 1053-5
    [PMID:22037706]
  12. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]