PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G19510.1
Common NameHAT3.1, MLD14.25, MLD14.37
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family HB-PHD
Protein Properties Length: 723aa    MW: 80461.5 Da    PI: 4.4341
Description Homeodomain-like protein with RING/FYVE/PHD-type zinc finger domain
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G19510.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox40.35.2e-13622666852
                  -HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHH CS
     Homeobox   8 tkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrR 52 
                  t+  +++L   F++n+yp+++++e LAk+l++t +qV +WF+ rR
  AT3G19510.1 622 TDPKTQRLYISFQENQYPDKATKESLAKELQMTVKQVNNWFKHRR 666
                  5667899999**********************************9 PP

2PHD40.56.4e-14267322151
                  SBTTTSS..TCTTSSEEEBSS.SSSEEETTTSTSSSSHHSHHSS..TBSSHHHHTT CS
          PHD   1 rCkvCgk..sdeegelvlCdg.CkewfHlkClglkleseekpeg..ewlCeeCkek 51 
                  +C+ Cg+     +++++lCdg C++ fH++Cl+++l++e++p +   wlC+ C++k
  AT3G19510.1 267 FCAKCGSkdLSVDNDIILCDGfCDRGFHQYCLEPPLRKEDIPPDdeGWLCPGCDCK 322
                  699***955445********88*******************99999*******985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF579036.2E-14257322IPR011011Zinc finger, FYVE/PHD-type
Gene3DG3DSA:3.30.40.102.1E-13263321IPR013083Zinc finger, RING/FYVE/PHD-type
PROSITE profilePS5001611.208265322IPR019787Zinc finger, PHD-finger
CDDcd155046.54E-28267319No hitNo description
PfamPF006281.9E-11267322IPR019787Zinc finger, PHD-finger
SMARTSM002491.5E-9267320IPR001965Zinc finger, PHD-type
PROSITE patternPS013590268319IPR019786Zinc finger, PHD-type, conserved site
Gene3DG3DSA:1.10.10.605.6E-14598666IPR009057Homeodomain-like
SMARTSM003898.5E-11614676IPR001356Homeobox domain
SuperFamilySSF466892.22E-12617668IPR009057Homeodomain-like
PROSITE profilePS5007112.244622672IPR001356Homeobox domain
CDDcd000861.03E-12622666No hitNo description
PfamPF000461.5E-10622666IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000005anatomycultured plant cell
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 723 aa     Download sequence    Send to blast
MYKAVSKRVT RSSGSGLKQT NVDNGGEISP TVDRVSEQGK SSEAGSHMPT DANGNGHLHH  60
EIMDHGKGNE EQKPTPQTVK KDSNTNTKFS GSHRELVIGL PCRGQFEIHN RSRASTSSKR  120
LGGGGERNVL FASHKRAQRS KEDAGPSSVV ANSTPVGRPK KKNKTMNKGQ VREDDEYTRI  180
KKKLRYFLNR INYEQSLIDA YSLEGWKGSS LEKIRPEKEL ERATKEILRR KLKIRDLFQH  240
LDTLCAEGSL PESLFDTDGE ISSEDIFCAK CGSKDLSVDN DIILCDGFCD RGFHQYCLEP  300
PLRKEDIPPD DEGWLCPGCD CKDDSLDLLN DSLGTKFSVS DSWEKIFPEA AAALVGGGQN  360
LDCDLPSDDS DDEEYDPDCL NDNENDEDGS DDNEESENED GSSDETEFTS ASDEMIESFK  420
EGKDIMKDVM ALPSDDSEDD DYDPDAPTCD DDKESSNSDC TSDTEDLETS FKGDETNQQA  480
EDTPLEDPGR QTSQLQGDAI LESDVGLDDG PAGVSRRRNV ERLDYKKLYD EEYDNVPTSS  540
SDDDDWDKTA RMGKEDSESE DEGDTVPLKQ SSNAEDHTSK KLIRKSKRAD KKDTLEMPQE  600
GPGENGGSGE IEKSSSSACK QTDPKTQRLY ISFQENQYPD KATKESLAKE LQMTVKQVNN  660
WFKHRRWSIN SKPLVSEENV EKLKTGKEGE CETSVAGSSK QTMETESVAE KPTNTGSRKR  720
RRK
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1178184RIKKKLR
2717721RKRRR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.196940.0inflorescence
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1865102290.0
Genevisible258011_at0.0
Expression AtlasAT3G19510-
AtGenExpressAT3G19510-
ATTED-IIAT3G19510-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Primarily detected in root tissue.
Functional Description ? help Back to Top
Source Description
TAIREncodes a member of the PHD-finger homeodomain protein family. The HAT3.1 homeodomain is highly divergent in sequence even at positions that are almost invariable among homeodomains. HAT3.1 shows a preference for the sequence T(A/G)(A/C)ACCA, different from those bound by other homeodomains.
UniProtBinds only to large DNA fragments. Recognizes a DNA fragment carrying 8 copies of box7 motif of the light-induced cab-E promoter of Nicotiana plumbaginifolia. Also recognizes the box7m1 motif.
Function -- GeneRIF ? help Back to Top
  1. The interaction of HAT3.1 with specific DNA binding by a homeodomain protein with histidine at position 51 was studied.
    [PMID: 17530779]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G19510.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
IntActSearch Q04996
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G19510
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0059650.0BT005965.1 Arabidopsis thaliana At3g19510 gene, complete cds.
GenBankAK1171050.0AK117105.1 Arabidopsis thaliana At3g19510 mRNA for putative homeobox protein HAT3.1, complete cds, clone: RAFL16-64-G01.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_188582.10.0homeobox protein HAT3.1
SwissprotQ049960.0HAT31_ARATH; Homeobox protein HAT3.1
TrEMBLD7L9Z90.0D7L9Z9_ARALL; Putative uncharacterized protein
STRINGAT3G19510.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP18301539
MalvidsOGEM72702543
Publications ? help Back to Top
  1. Halbach T,Scheer N,Werr W
    Transcriptional activation by the PHD finger is inhibited through an adjacent leucine zipper that binds 14-3-3 proteins.
    Nucleic Acids Res., 2000. 28(18): p. 3542-50
    [PMID:10982874]
  2. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  3. Seki M, et al.
    Functional annotation of a full-length Arabidopsis cDNA collection.
    Science, 2002. 296(5565): p. 141-5
    [PMID:11910074]
  4. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  5. Tan QK,Irish VF
    The Arabidopsis zinc finger-homeodomain genes encode proteins with unique biochemical properties that are coordinately expressed during floral development.
    Plant Physiol., 2006. 140(3): p. 1095-108
    [PMID:16428600]
  6. Viola IL,Gonzalez DH
    Interaction of the PHD-finger homeodomain protein HAT3.1 from Arabidopsis thaliana with DNA. Specific DNA binding by a homeodomain with histidine at position 51.
    Biochemistry, 2007. 46(25): p. 7416-25
    [PMID:17530779]
  7. Shin R,Jez JM,Basra A,Zhang B,Schachtman DP
    14-3-3 proteins fine-tune plant nutrient metabolism.
    FEBS Lett., 2011. 585(1): p. 143-7
    [PMID:21094157]
  8. Arabidopsis Interactome Mapping Consortium
    Evidence for network evolution in an Arabidopsis interactome map.
    Science, 2011. 333(6042): p. 601-7
    [PMID:21798944]
  9. Schindler U,Beckmann H,Cashmore AR
    HAT3.1, a novel Arabidopsis homeodomain protein containing a conserved cysteine-rich region.
    Plant J., 1993. 4(1): p. 137-50
    [PMID:8106082]