PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G19290.1
Common NameABF4, AREB2, BZIP38, MVI11.7
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family bZIP
Protein Properties Length: 431aa    MW: 46492.1 Da    PI: 10.1974
Description ABRE binding factor 4
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G19290.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_142.11.9e-13353404556
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkev 56 
                  +r+rr++kNRe+A rsR+RK+a++ eLe ++++L++ N++L+k+  e+ ++ 
  AT3G19290.1 353 RRQRRMIKNRESAARSRARKQAYTLELEAEIEKLKKTNQELQKKQAEMVEMQ 404
                  69***************************************97655554443 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003387.5E-11349414IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.726351400IPR004827Basic-leucine zipper domain
PfamPF001705.6E-11353405IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.34E-10353402No hitNo description
CDDcd147075.61E-23353400No hitNo description
Gene3DG3DSA:1.20.5.1702.9E-13353402No hitNo description
PROSITE patternPS000360356371IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0009738Biological Processabscisic acid-activated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1900057Biological Processpositive regulation of leaf senescence
GO:1903648Biological Processpositive regulation of chlorophyll catabolic process
GO:0005634Cellular Componentnucleus
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000005anatomycultured plant cell
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000084anatomyplant sperm cell
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 431 aa     Download sequence    Send to blast
MGTHINFNNL GGGGHPGGEG SSNQMKPTGS VMPLARQSSV YSLTFDELQN TLGGPGKDFG  60
SMNMDELLKS IWTAEEAQAM AMTSAPAATA VAQPGAGIPP PGGNLQRQGS LTLPRTISQK  120
TVDEVWKCLI TKDGNMEGSS GGGGESNVPP GRQQTLGEMT LEEFLFRAGV VREDNCVQQM  180
GQVNGNNNNG FYGNSTAAGG LGFGFGQPNQ NSITFNGTND SMILNQPPGL GLKMGGTMQQ  240
QQQQQQLLQQ QQQQMQQLNQ PHPQQRLPQT IFPKQANVAF SAPVNITNKG FAGAANNSIN  300
NNNGLASYGG TGVTVAATSP GTSSAENNSL SPVPYVLNRG RRSNTGLEKV IERRQRRMIK  360
NRESAARSRA RKQAYTLELE AEIEKLKKTN QELQKKQAEM VEMQKNELKE TSKRPWGSKR  420
QCLRRTLTGP W
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.239930.0flower| silique
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible258026_at0.0
Expression AtlasAT3G19290-
AtGenExpressAT3G19290-
ATTED-IIAT3G19290-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, leaves, flowers and immatures siliques. {ECO:0000269|PubMed:11005831, ECO:0000269|PubMed:11884679}.
Functional Description ? help Back to Top
Source Description
TAIRbZIP transcription factor with specificity for abscisic acid-responsive elements (ABRE). Mediate ABA-dependent stress responses.
UniProtFunctions as transcriptional activator in the ABA-inducible expression of rd29B. Binds specifically to the ABA-responsive element (ABRE) of the rd29B gene promoter. {ECO:0000269|PubMed:11005831, ECO:0000269|PubMed:11884679, ECO:0000269|PubMed:15361142, ECO:0000269|PubMed:16463099}.
Function -- GeneRIF ? help Back to Top
  1. CPK32 is an ABA signaling component that regulates the ABA-responsive gene expression via ABF4.
    [PMID: 16299177]
  2. AREB1, AREB2, and ABF3 are master transcription factors that regulate the ABRE-dependent expression of water-stress responsive genes in ABA signaling in response to water stresses in a cooperative manner.
    [PMID: 19947981]
  3. Data show that the HD-Zip protein Athb-21 and B-3 AP2/ERF transcription factor ESE1 are interact with the abscisic acid responsive element binding factor AREB2/ABF4, which binds to a G-box absolutely required for expression of the COX5b-1 gene.
    [PMID: 22669746]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G19290.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by drought, salt, abscisic acid (ABA) and cold. {ECO:0000269|PubMed:10636868, ECO:0000269|PubMed:11005831, ECO:0000269|PubMed:16284313, ECO:0000269|PubMed:16463099}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Upstream Regulators) ? help Back to Top
Source Upstream Regulator (A: Activate/R: Repress)
ATRM AT3G24650 (R)
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT5G52300(A)
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDabscisic acid
Interaction ? help Back to Top
Source Intact With
BioGRIDAT3G19290, AT3G23220, AT4G25480, AT4G34000, AT5G05410, AT1G45249, AT1G49720
IntActSearch Q9M7Q2
Phenotype -- Disruption Phenotype ? help Back to Top
Source Description
UniProtDISRUPTION PHENOTYPE: Defective in ABA and stress responses. {ECO:0000269|PubMed:15361142}.
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G19290
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF0935470.0AF093547.1 Arabidopsis thaliana clone 19 abscisic acid responsive elements-binding factor (ABRE) mRNA, partial cds.
GenBankAY0912980.0AY091298.1 Arabidopsis thaliana putative abscisic acid responsive elements-binding factor (At3g19290) mRNA, complete cds.
GenBankAY0508970.0AY050897.1 Arabidopsis thaliana putative abscisic acid responsive elements-binding factor (At3g19290) mRNA, complete cds.
GenBankAB0171610.0AB017161.1 Arabidopsis thaliana mRNA for ABA-responsive element binding protein 2 (AREB2), complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_566629.10.0ABRE binding factor 4
SwissprotQ9M7Q20.0AI5L7_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 7
TrEMBLF4JB530.0F4JB53_ARATH; ABRE binding factor 4
STRINGAT3G19290.30.0(Arabidopsis thaliana)
Publications ? help Back to Top
  1. Choi H,Hong J,Ha J,Kang J,Kim SY
    ABFs, a family of ABA-responsive element binding factors.
    J. Biol. Chem., 2000. 275(3): p. 1723-30
    [PMID:10636868]
  2. Finkelstein RR,Lynch TJ
    The Arabidopsis abscisic acid response gene ABI5 encodes a basic leucine zipper transcription factor.
    Plant Cell, 2000. 12(4): p. 599-609
    [PMID:10760247]
  3. Uno Y, et al.
    Arabidopsis basic leucine zipper transcription factors involved in an abscisic acid-dependent signal transduction pathway under drought and high-salinity conditions.
    Proc. Natl. Acad. Sci. U.S.A., 2000. 97(21): p. 11632-7
    [PMID:11005831]
  4. Riechmann JL,Ratcliffe OJ
    A genomic perspective on plant transcription factors.
    Curr. Opin. Plant Biol., 2000. 3(5): p. 423-34
    [PMID:11019812]
  5. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  6. Kang JY,Choi HI,Im MY,Kim SY
    Arabidopsis basic leucine zipper proteins that mediate stress-responsive abscisic acid signaling.
    Plant Cell, 2002. 14(2): p. 343-57
    [PMID:11884679]
  7. Jakoby M, et al.
    bZIP transcription factors in Arabidopsis.
    Trends Plant Sci., 2002. 7(3): p. 106-11
    [PMID:11906833]
  8. Im YJ,Han O,Chung GC,Cho BH
    Antisense expression of an Arabidopsis omega-3 fatty acid desaturase gene reduces salt/drought tolerance in transgenic tobacco plants.
    Mol. Cells, 2002. 13(2): p. 264-71
    [PMID:12018849]
  9. Bensmihen S, et al.
    The homologous ABI5 and EEL transcription factors function antagonistically to fine-tune gene expression during late embryogenesis.
    Plant Cell, 2002. 14(6): p. 1391-403
    [PMID:12084834]
  10. Suzuki M,Ketterling MG,Li QB,McCarty DR
    Viviparous1 alters global gene expression patterns through regulation of abscisic acid signaling.
    Plant Physiol., 2003. 132(3): p. 1664-77
    [PMID:12857845]
  11. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  12. Kim S,Kang JY,Cho DI,Park JH,Kim SY
    ABF2, an ABRE-binding bZIP factor, is an essential component of glucose signaling and its overexpression affects multiple stress tolerance.
    Plant J., 2004. 40(1): p. 75-87
    [PMID:15361142]
  13. Fujita Y, et al.
    AREB1 Is a transcription activator of novel ABRE-dependent ABA signaling that enhances drought stress tolerance in Arabidopsis.
    Plant Cell, 2005. 17(12): p. 3470-88
    [PMID:16284313]
  14. Choi HI, et al.
    Arabidopsis calcium-dependent protein kinase AtCPK32 interacts with ABF4, a transcriptional regulator of abscisic acid-responsive gene expression, and modulates its activity.
    Plant Physiol., 2005. 139(4): p. 1750-61
    [PMID:16299177]
  15. Furihata T, et al.
    Abscisic acid-dependent multisite phosphorylation regulates the activity of a transcription activator AREB1.
    Proc. Natl. Acad. Sci. U.S.A., 2006. 103(6): p. 1988-93
    [PMID:16446457]
  16. Nakashima K, et al.
    Transcriptional regulation of ABI3- and ABA-responsive genes including RD29B and RD29A in seeds, germinating embryos, and seedlings of Arabidopsis.
    Plant Mol. Biol., 2006. 60(1): p. 51-68
    [PMID:16463099]
  17. Popescu SC, et al.
    Differential binding of calmodulin-related proteins to their targets revealed through high-density Arabidopsis protein microarrays.
    Proc. Natl. Acad. Sci. U.S.A., 2007. 104(11): p. 4730-5
    [PMID:17360592]
  18. Zhang Y, et al.
    SDIR1 is a RING finger E3 ligase that positively regulates stress-responsive abscisic acid signaling in Arabidopsis.
    Plant Cell, 2007. 19(6): p. 1912-29
    [PMID:17573536]
  19. Zhu SY, et al.
    Two calcium-dependent protein kinases, CPK4 and CPK11, regulate abscisic acid signal transduction in Arabidopsis.
    Plant Cell, 2007. 19(10): p. 3019-36
    [PMID:17921317]
  20. Garcia ME,Lynch T,Peeters J,Snowden C,Finkelstein R
    A small plant-specific protein family of ABI five binding proteins (AFPs) regulates stress response in germinating Arabidopsis seeds and seedlings.
    Plant Mol. Biol., 2008. 67(6): p. 643-58
    [PMID:18484180]
  21. Comelli RN,Viola IL,Gonzalez DH
    Characterization of promoter elements required for expression and induction by sucrose of the Arabidopsis COX5b-1 nuclear gene, encoding the zinc-binding subunit of cytochrome c oxidase.
    Plant Mol. Biol., 2009. 69(6): p. 729-43
    [PMID:19125337]
  22. Yoshida T, et al.
    AREB1, AREB2, and ABF3 are master transcription factors that cooperatively regulate ABRE-dependent ABA signaling involved in drought stress tolerance and require ABA for full activation.
    Plant J., 2010. 61(4): p. 672-85
    [PMID:19947981]
  23. Lee SJ, et al.
    DREB2C interacts with ABF2, a bZIP protein regulating abscisic acid-responsive gene expression, and its overexpression affects abscisic acid sensitivity.
    Plant Physiol., 2010. 153(2): p. 716-27
    [PMID:20395451]
  24. Kriegs B, et al.
    Cyclic monoterpene mediated modulations of Arabidopsis thaliana phenotype: effects on the cytoskeleton and on the expression of selected genes.
    Plant Signal Behav, 2010. 5(7): p. 832-8
    [PMID:20484979]
  25. Kline KG,Barrett-Wilt GA,Sussman MR
    In planta changes in protein phosphorylation induced by the plant hormone abscisic acid.
    Proc. Natl. Acad. Sci. U.S.A., 2010. 107(36): p. 15986-91
    [PMID:20733066]
  26. Li G, et al.
    Two cotton Cys2/His2-type zinc-finger proteins, GhDi19-1 and GhDi19-2, are involved in plant response to salt/drought stress and abscisic acid signaling.
    Plant Mol. Biol., 2010. 74(4-5): p. 437-52
    [PMID:20852918]
  27. Kim YY,Jung KW,Yoo KS,Jeung JU,Shin JS
    A stress-responsive caleosin-like protein, AtCLO4, acts as a negative regulator of ABA responses in Arabidopsis.
    Plant Cell Physiol., 2011. 52(5): p. 874-84
    [PMID:21471120]
  28. Zhao R, et al.
    The Arabidopsis Ca(2+) -dependent protein kinase CPK12 negatively regulates abscisic acid signaling in seed germination and post-germination growth.
    New Phytol., 2011. 192(1): p. 61-73
    [PMID:21692804]
  29. Rushton DL, et al.
    WRKY transcription factors: key components in abscisic acid signalling.
    Plant Biotechnol. J., 2012. 10(1): p. 2-11
    [PMID:21696534]
  30. Arabidopsis Interactome Mapping Consortium
    Evidence for network evolution in an Arabidopsis interactome map.
    Science, 2011. 333(6042): p. 601-7
    [PMID:21798944]
  31. Kim JS, et al.
    An ABRE promoter sequence is involved in osmotic stress-responsive expression of the DREB2A gene, which encodes a transcription factor regulating drought-inducible genes in Arabidopsis.
    Plant Cell Physiol., 2011. 52(12): p. 2136-46
    [PMID:22025559]
  32. Gaudinier A, et al.
    Enhanced Y1H assays for Arabidopsis.
    Nat. Methods, 2011. 8(12): p. 1053-5
    [PMID:22037706]
  33. Zhao R,Wang XF,Zhang DP
    CPK12: A Ca2+-dependent protein kinase balancer in abscisic acid signaling.
    Plant Signal Behav, 2011. 6(11): p. 1687-90
    [PMID:22041934]
  34. Curran A, et al.
    Calcium-dependent protein kinases from Arabidopsis show substrate specificity differences in an analysis of 103 substrates.
    Front Plant Sci, 2011. 2: p. 36
    [PMID:22645532]
  35. Comelli RN,Welchen E,Kim HJ,Hong JC,Gonzalez DH
    Delta subclass HD-Zip proteins and a B-3 AP2/ERF transcription factor interact with promoter elements required for expression of the Arabidopsis cytochrome c oxidase 5b-1 gene.
    Plant Mol. Biol., 2012. 80(2): p. 157-67
    [PMID:22669746]
  36. Luo X, et al.
    Over-expression of GsZFP1, an ABA-responsive C2H2-type zinc finger protein lacking a QALGGH motif, reduces ABA sensitivity and decreases stomata size.
    J. Plant Physiol., 2012. 169(12): p. 1192-202
    [PMID:22705253]
  37. Lynch T,Erickson BJ,Finkelstein RR
    Direct interactions of ABA-insensitive(ABI)-clade protein phosphatase(PP)2Cs with calcium-dependent protein kinases and ABA response element-binding bZIPs may contribute to turning off ABA response.
    Plant Mol. Biol., 2012. 80(6): p. 647-58
    [PMID:23007729]
  38. Luo X, et al.
    Expression of wild soybean WRKY20 in Arabidopsis enhances drought tolerance and regulates ABA signalling.
    J. Exp. Bot., 2013. 64(8): p. 2155-69
    [PMID:23606412]
  39. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]