PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G18650.1
Common NameAGL103
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family M-type_MADS
Protein Properties Length: 386aa    MW: 43551.6 Da    PI: 9.1996
Description AGAMOUS-like 103
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G18650.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF71.85.9e-232973650
                 HHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
       SRF-TF  6 ksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                 +s r ++++kR+++++KKA+ELS+LCd++v+vi ++s+g+l++++
  AT3G18650.1 29 SSSRATSLIKRQQTVFKKAKELSILCDIDVCVICYGSNGELKTWP 73
                 5789****************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004328.1E-71475IPR002100Transcription factor, MADS-box
CDDcd002665.63E-2318100No hitNo description
PROSITE profilePS5006612.8952976IPR002100Transcription factor, MADS-box
SuperFamilySSF554559.68E-1929108IPR002100Transcription factor, MADS-box
PfamPF003192.3E-153072IPR002100Transcription factor, MADS-box
PRINTSPR004048.3E-63853IPR002100Transcription factor, MADS-box
PRINTSPR004048.3E-65374IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020090anatomyembryo sac central cell
Sequence ? help Back to Top
Protein Sequence    Length: 386 aa     Download sequence    Send to blast
MASSSSSSLS FSTSKKNKTF FKKPNSAFSS SRATSLIKRQ QTVFKKAKEL SILCDIDVCV  60
ICYGSNGELK TWPEEREKVK AIARRYGELS ETKRRKGSVD LHEFLEKMNK DDPEKEEKKK  120
IKVRRVPKVK YPVWDPRFDN YSVEQLMGLV QSLERNLTRI QHRTCAVVEA QGQRRVQYTN  180
MANQELMMAN TMNQLQQHSN QVSMYLWNHG NGAFSQIPVS ALASNQTQSL APIPPELMIY  240
PNSDAGNYSG SLGVQGTGIN GLQNMNMLTY NNINSVNDFS KQFDQNSRAE SYSSLLGVHE  300
DGNNEFENPN MSSRNNFNVQ DCAGLLGMQG AGTNGLQSMN MHDYSNNNSI NSNGLSHQYV  360
QFPTYNSQHQ DRVFNLDQNG NNTRSL
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO184019580.0
Genevisible257549_at0.0
Expression AtlasAT3G18650-
AtGenExpressAT3G18650-
ATTED-IIAT3G18650-
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that may function in the maintenance of the proper function of the central cell in pollen tube attraction. {ECO:0000305|PubMed:26462908}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G18650.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
BioGRIDAT5G04640, AT5G27130, AT1G31640, AT1G46408, AT1G47760, AT1G48150, AT1G60880, AT1G60920
IntActSearch Q9LSB2
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G18650
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0266540.0AB026654.1 Arabidopsis thaliana genomic DNA, chromosome 3, P1 clone: MVE11.
GenBankBT0295490.0BT029549.1 Arabidopsis thaliana At3g18650 mRNA, complete cds.
GenBankCP0026860.0CP002686.1 Arabidopsis thaliana chromosome 3, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_188495.10.0AGAMOUS-like 103
SwissprotQ9LSB20.0AG103_ARATH; Agamous-like MADS-box protein AGL103
TrEMBLA0A178V6E80.0A0A178V6E8_ARATH; AGL103
STRINGAT3G18650.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM56620126
Representative plantOGRP6766218
Publications ? help Back to Top
  1. De Bodt S, et al.
    Genomewide structural annotation and evolutionary analysis of the type I MADS-box genes in plants.
    J. Mol. Evol., 2003. 56(5): p. 573-86
    [PMID:12698294]
  2. Parenicov√° L, et al.
    Molecular and phylogenetic analyses of the complete MADS-box transcription factor family in Arabidopsis: new openings to the MADS world.
    Plant Cell, 2003. 15(7): p. 1538-51
    [PMID:12837945]
  3. Kofuji R, et al.
    Evolution and divergence of the MADS-box gene family based on genome-wide expression analyses.
    Mol. Biol. Evol., 2003. 20(12): p. 1963-77
    [PMID:12949148]
  4. Dal Bosco C, et al.
    Inactivation of the chloroplast ATP synthase gamma subunit results in high non-photochemical fluorescence quenching and altered nuclear gene expression in Arabidopsis thaliana.
    J. Biol. Chem., 2004. 279(2): p. 1060-9
    [PMID:14576160]
  5. de Folter S, et al.
    Comprehensive interaction map of the Arabidopsis MADS Box transcription factors.
    Plant Cell, 2005. 17(5): p. 1424-33
    [PMID:15805477]
  6. Bemer M,Heijmans K,Airoldi C,Davies B,Angenent GC
    An atlas of type I MADS box gene expression during female gametophyte and seed development in Arabidopsis.
    Plant Physiol., 2010. 154(1): p. 287-300
    [PMID:20631316]
  7. Li HJ, et al.
    Arabidopsis CBP1 Is a Novel Regulator of Transcription Initiation in Central Cell-Mediated Pollen Tube Guidance.
    Plant Cell, 2015. 27(10): p. 2880-93
    [PMID:26462908]
  8. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]