PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G18400.1
Common Nameanac058, NAC058
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 314aa    MW: 35744.9 Da    PI: 6.5191
Description NAC domain containing protein 58
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G18400.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM179.68.1e-5651311129
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 
                  lppGfrFhPtdeel+++yL++kv++  ++  +++ +vd++k+ePwdLp+k++ +ekewyfFs+rd+ky+tg r+nrat++gyWk+tgkdke+++ +g 
  AT3G18400.1   5 LPPGFRFHPTDEELITHYLCRKVSDIGFTG-KAVVDVDLNKCEPWDLPAKASMGEKEWYFFSQRDRKYPTGLRTNRATEAGYWKTTGKDKEIYR-SGV 100
                  79*************************999.88***************999999****************************************.999 PP

          NAM  99 lvglkktLvfykgrapkgektdWvmheyrle 129
                  lvg+kktLvfykgrapkgek++Wvmheyrle
  AT3G18400.1 101 LVGMKKTLVFYKGRAPKGEKSNWVMHEYRLE 131
                  *****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.27E-643152IPR003441NAC domain
PROSITE profilePS5100560.5575152IPR003441NAC domain
PfamPF023651.7E-296130IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007275Biological Processmulticellular organism development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009005anatomyroot
PO:0009046anatomyflower
PO:0020100anatomyhypocotyl
PO:0007611developmental stagepetal differentiation and expansion stage
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MEENLPPGFR FHPTDEELIT HYLCRKVSDI GFTGKAVVDV DLNKCEPWDL PAKASMGEKE  60
WYFFSQRDRK YPTGLRTNRA TEAGYWKTTG KDKEIYRSGV LVGMKKTLVF YKGRAPKGEK  120
SNWVMHEYRL ESKQPFNPTN KEEWVVCRVF EKSTAAKKAQ EQQPQSSQPS FGSPCDANSS  180
MANEFEDIDE LPNLNSNSST IDYNNHIHQY SQRNVYSEDN TTSTAGLNMN MNMASTNLQS  240
WTTSLLGPPL SPINSLLLKA FQIRNSYSFP KEMIPSFNHS SLQQGVSNMI QNASSSSQVQ  300
PQPQEEAFNM DSIW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B9e-61415816171NAC domain-containing protein 19
4dul_A9e-61415816171NAC domain-containing protein 19
1ut7_B9e-61415816171NO APICAL MERISTEM PROTEIN
1ut7_A9e-61415816171NO APICAL MERISTEM PROTEIN
1ut4_B9e-61415816171NO APICAL MERISTEM PROTEIN
1ut4_A9e-61415816171NO APICAL MERISTEM PROTEIN
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible257718_at0.0
Expression AtlasAT3G18400-
AtGenExpressAT3G18400-
ATTED-IIAT3G18400-
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00364DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G18400.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G18400
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0026860.0CP002686.1 Arabidopsis thaliana chromosome 3, complete sequence.
GenBankAB0266580.0AB026658.1 Arabidopsis thaliana genomic DNA, chromosome 3, P1 clone: MYF24.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_188469.10.0NAC domain containing protein 58
SwissprotQ9FLJ22e-83NC100_ARATH; NAC domain-containing protein 100
TrEMBLQ9LS500.0Q9LS50_ARATH; NAC domain containing protein 58
STRINGAT3G18400.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1715800
MalvidsOGEM55272649
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Ooka H, et al.
    Comprehensive analysis of NAC family genes in Oryza sativa and Arabidopsis thaliana.
    DNA Res., 2003. 10(6): p. 239-47
    [PMID:15029955]