PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G18100.2
Common NameAtMYB4R1, MYB4R1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 634aa    MW: 72601.2 Da    PI: 9.3702
Description myb domain protein 4r1
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G18100.2genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding24.37.4e-08230274246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g+WT+ Ed+ l++ ++q    +W  Ia  +g++Rt+ qc  r+q 
      AT3G18100.2 230 GPWTAAEDKNLLRTIEQTSLTDWVDIAVSLGTNRTPFQCLARYQR 274
                      89*****************************************96 PP

2Myb_DNA-binding46.49.3e-15282326146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      ++ WT+eEd++l  av+++G ++W ++a+ +  gRt+ qc +rw k
      AT3G18100.2 282 KKEWTAEEDDQLRTAVELFGEKDWQSVANVLK-GRTGTQCSNRWKK 326
                      679****************************9.***********98 PP

3Myb_DNA-binding51.52.4e-16333378147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +g W+ eEd++ + av+++G+ +W++I++ ++ gRt  qc++rw++ 
      AT3G18100.2 333 KGTWSLEEDKRVKVAVTLFGSQNWHKISQFVP-GRTQTQCRERWLNC 378
                      799*****************************.***********996 PP

4Myb_DNA-binding46.39.4e-15385428146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+WT+eEde+l +a++++G   W+++a  +   Rt++qc  rw  
      AT3G18100.2 385 RGKWTEEEDEKLREAIAEHGYS-WSKVATNLS-CRTDNQCLRRWKR 428
                      89******************99.*********.***********86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500905.03130223IPR017877Myb-like domain
SMARTSM0071713134225IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.0E-6137153IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.0E-6199236IPR009057Homeodomain-like
SuperFamilySSF466894.39E-13207273IPR009057Homeodomain-like
PROSITE profilePS500908.711224276IPR017877Myb-like domain
SMARTSM007174.5E-7228278IPR001005SANT/Myb domain
PfamPF002494.0E-6230274IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.4E-13237289IPR009057Homeodomain-like
SuperFamilySSF466891.1E-21261331IPR009057Homeodomain-like
PROSITE profilePS5129423.219277332IPR017930Myb domain
SMARTSM007172.2E-15281330IPR001005SANT/Myb domain
PfamPF002499.2E-14282326IPR001005SANT/Myb domain
CDDcd001675.69E-12284328No hitNo description
Gene3DG3DSA:1.10.10.602.2E-17290330IPR009057Homeodomain-like
SMARTSM007172.4E-13332381IPR001005SANT/Myb domain
PfamPF002497.2E-15333378IPR001005SANT/Myb domain
PROSITE profilePS5129413.381333379IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.5E-21334384IPR009057Homeodomain-like
CDDcd001677.84E-10335377No hitNo description
SuperFamilySSF466899.35E-26359434IPR009057Homeodomain-like
PROSITE profilePS5129427.785380434IPR017930Myb domain
SMARTSM007171.5E-12384432IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-19385429IPR009057Homeodomain-like
PfamPF002491.5E-13385429IPR001005SANT/Myb domain
CDDcd001672.61E-10387429No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0030154Biological Processcell differentiation
GO:0042795Biological ProcesssnRNA transcription from RNA polymerase II promoter
GO:0042796Biological ProcesssnRNA transcription from RNA polymerase III promoter
GO:0019185Cellular ComponentsnRNA-activating protein complex
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000084anatomyplant sperm cell
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025195anatomypollen tube cell
PO:0025281anatomypollen
PO:0001017developmental stageM germinated pollen stage
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 634 aa     Download sequence    Send to blast
MPAASSSFPE AARAFVDAIR RNRAYQKFLR GKLAEIEATI EQNEKHKKNV RIVKDFQASC  60
KRITKLALCQ RKDPRVELIS TRKSGPCDSS EVIGPCDSFE GNDKKISPLT LGPAENPCVE  120
NYRMALEKYP ISVKRRKWST EENKNLAKGL KQEVQKILLS EAIERSSDLE GATYDIDTIN  180
ESIGNLEITP EMIRQFLPKI NWDSLDIKDR SAAECEARWM SSEDPLINHG PWTAAEDKNL  240
LRTIEQTSLT DWVDIAVSLG TNRTPFQCLA RYQRSLNPSI LKKEWTAEED DQLRTAVELF  300
GEKDWQSVAN VLKGRTGTQC SNRWKKSLRP TRKGTWSLEE DKRVKVAVTL FGSQNWHKIS  360
QFVPGRTQTQ CRERWLNCLD PKVNRGKWTE EEDEKLREAI AEHGYSWSKV ATNLSCRTDN  420
QCLRRWKRLY PHQVALLQEA RRLQKEASVG NFVDRESERP ALVTSPILAL PDISLEPEPD  480
SVALKKKRKA KQKKSDAERQ PKRRRKGLKN CSGDVCRQEN ETVCENEPNN GGEERMLALE  540
CHDEIQDNAK EKPKQRRKSV AETVCENEPN NGGEERMLAL ECDNEIQDNA KEKRKRRRKS  600
VAETSNNTTG LKKLTPRRRK ISAVVPIKNQ DAPN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h89_C6e-311914266159MYB PROTO-ONCOGENE PROTEIN
1h88_C6e-311914266159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1486504KRKAKQKKSDAERQPKRRR
2486505KRKAKQKKSDAERQPKRRRK
3592597KRKRRR
4592598KRKRRRK
5593597RKRRR
6615619PRRRK
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO306847780.0
Genevisible258157_at0.0
Expression AtlasAT3G18100-
AtGenExpressAT3G18100-
ATTED-IIAT3G18100-
Functional Description ? help Back to Top
Source Description
TAIRMember of the R2R3 transcription factor gene family.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G18100.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G18100
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0338270.0AY033827.1 Arabidopsis thaliana putative transcription factor (MYB4R1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_566597.10.0myb domain protein 4r1
TrEMBLQ9LV310.0Q9LV31_ARATH; Myb domain protein 4r1
STRINGAT3G18100.10.0(Arabidopsis thaliana)
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  3. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  4. Wang Y, et al.
    Transcriptome analyses show changes in gene expression to accompany pollen germination and tube growth in Arabidopsis.
    Plant Physiol., 2008. 148(3): p. 1201-11
    [PMID:18775970]