PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G18010.1
Common NameMEB5.20, MEB5.23, WOX1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family WOX
Protein Properties Length: 350aa    MW: 40142.7 Da    PI: 7.4269
Description WUSCHEL related homeobox 1
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G18010.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox68.77.5e-2275134357
                  --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
     Homeobox   3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                  +R+++t++ql++Leel+++ +r+psa+++++++++l    +++ ++V++WFqN++a+e++
  AT3G18010.1  75 SRWNPTPDQLRVLEELYRQgTRTPSADHIQQITAQLrrygKIEGKNVFYWFQNHKARERQ 134
                  7*****************99**************************************97 PP

2Wus_type_Homeobox117.94.5e-3874136365
  Wus_type_Homeobox   3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                        ++RW+Ptp+Q+++Leely++G+rtP++++iq+ita+L++yGkie+kNVfyWFQN+kaRerqk+
        AT3G18010.1  74 SSRWNPTPDQLRVLEELYRQGTRTPSADHIQQITAQLRRYGKIEGKNVFYWFQNHKARERQKR 136
                        79***********************************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003892.1E-572139IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.604.3E-975134IPR009057Homeodomain-like
PfamPF000461.5E-1975134IPR001356Homeobox domain
SuperFamilySSF466894.38E-1275140IPR009057Homeodomain-like
CDDcd000867.32E-676136No hitNo description
PROSITE profilePS5007110.86780135IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048513Biological Processanimal organ development
GO:0099402Biological Processplant organ development
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000015anatomycotyledon primordium
PO:0000293anatomyguard cell
PO:0009006anatomyshoot system
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0004507developmental stageplant embryo bilateral stage
Sequence ? help Back to Top
Protein Sequence    Length: 350 aa     Download sequence    Send to blast
MWTMGYNEGG ADSFNGGRKL RPLIPRLTSC PTAAVNTNSD HRFNMAVVTM TAEQNKRELM  60
MLNSEPQHPP VMVSSRWNPT PDQLRVLEEL YRQGTRTPSA DHIQQITAQL RRYGKIEGKN  120
VFYWFQNHKA RERQKRRRQM ETGHEETVLS TASLVSNHGF DKKDPPGYKV EQVKNWICSV  180
GCDTQPEKPS RDYHLEEPAN IRVEHNARCG GDERRSFLGI NTTWQMMQLP PSFYSSSHHH  240
HQRNLILNSP TVSSNMSNSN NAVSASKDTV TVSPVFLRTR EATNTETCHR NGDDNKDQEQ  300
HEDCSNGELD HQEQTLELFP LRKEGFCSDG EKDKNISGIH CFYEFLPLKN
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1453386570.0
Expression AtlasAT3G18010-
AtGenExpressAT3G18010-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Specifically expressed during initiation of the shoot apical meristem, when cotyledonary primordia arise at the flanks of the apical embryo domain phase. Confined to the initiating vascular primordium of the cotyledons during heart and torpedo stages, but only weakly expressed during bent cotyledon stage. {ECO:0000269|PubMed:14711878}.
Functional Description ? help Back to Top
Source Description
TAIREncodes a WUSCHEL-related homeobox gene family member with 65 amino acids in its homeodomain. Proteins in this family contain a sequence of eight residues (TLPLFPMH) downstream of the homeodomain called the WUS box. Its mRNA is expressed in the initiating vascular primordium of the cotyledons during heart and torpedo stages.
UniProtTranscription factor which may be involved in developmental processes. {ECO:0000250}.
Function -- GeneRIF ? help Back to Top
  1. Data indicate a conserved role for WOX1 genes in regulating lateral organ development.
    [PMID: 19717616]
  2. WOX1 plays an important role in meristem development in Arabidopsis.
    [PMID: 21658178]
  3. Specific expression of PRS and WOX1 in a domain between the adaxial and abaxial domains is important for lateral-specific blade outgrowth and margin-specific cell fate.
    [PMID: 22374393]
  4. These data points to a general requirement for AS2 repression in meristematic regions to allow cell proliferation.
    [PMID: 25807065]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G18010.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G18010
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY2513940.0AY251394.1 Arabidopsis thaliana WOX1 protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_188428.30.0WUSCHEL-related homeobox 1
SwissprotQ6X7K00.0WOX1_ARATH; WUSCHEL-related homeobox 1
TrEMBLD7L7Y50.0D7L7Y5_ARALL; WOX1 protein
STRINGAT3G18010.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP8416716
MalvidsOGEM73972741
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. R
    Rapid identification of Arabidopsis insertion mutants by non-radioactive detection of T-DNA tagged genes.
    Plant J., 2002. 32(2): p. 243-53
    [PMID:12383089]
  3. Haecker A, et al.
    Expression dynamics of WOX genes mark cell fate decisions during early embryonic patterning in Arabidopsis thaliana.
    Development, 2004. 131(3): p. 657-68
    [PMID:14711878]
  4. Czechowski T,Bari RP,Stitt M,Scheible WR,Udvardi MK
    Real-time RT-PCR profiling of over 1400 Arabidopsis transcription factors: unprecedented sensitivity reveals novel root- and shoot-specific genes.
    Plant J., 2004. 38(2): p. 366-79
    [PMID:15078338]
  5. Vandenbussche M, et al.
    Differential recruitment of WOX transcription factors for lateral development and organ fusion in Petunia and Arabidopsis.
    Plant Cell, 2009. 21(8): p. 2269-83
    [PMID:19717616]
  6. Hirakawa Y,Kondo Y,Fukuda H
    TDIF peptide signaling regulates vascular stem cell proliferation via the WOX4 homeobox gene in Arabidopsis.
    Plant Cell, 2010. 22(8): p. 2618-29
    [PMID:20729381]
  7. Zhang X,Zong J,Liu J,Yin J,Zhang D
    Genome-wide analysis of WOX gene family in rice, sorghum, maize, Arabidopsis and poplar.
    J Integr Plant Biol, 2010. 52(11): p. 1016-26
    [PMID:20977659]
  8. Ito J, et al.
    Analysis of the Arabidopsis cytosolic proteome highlights subcellular partitioning of central plant metabolism.
    J. Proteome Res., 2011. 10(4): p. 1571-82
    [PMID:21166475]
  9. Zhang Y, et al.
    Over-expression of WOX1 leads to defects in meristem development and polyamine homeostasis in Arabidopsis.
    J Integr Plant Biol, 2011. 53(6): p. 493-506
    [PMID:21658178]
  10. Nakata M, et al.
    Roles of the middle domain-specific WUSCHEL-RELATED HOMEOBOX genes in early development of leaves in Arabidopsis.
    Plant Cell, 2012. 24(2): p. 519-35
    [PMID:22374393]
  11. Nakata M,Okada K
    The three-domain model: a new model for the early development of leaves in Arabidopsis thaliana.
    Plant Signal Behav, 2012. 7(11): p. 1423-7
    [PMID:22951404]
  12. Zhang F,Tadege M
    Repression of AS2 by WOX family transcription factors is required for leaf development in Medicago and Arabidopsis.
    Plant Signal Behav, 2015. 10(7): p. e993291
    [PMID:25807065]