PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G17730.1
Common Nameanac057, NAC057
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 246aa    MW: 28248.3 Da    PI: 4.6733
Description NAC domain containing protein 57
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G17730.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM178.22.2e-5561331128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96 
                  lppGfrFhPtdeelv++yLk+k++g+++el ++i+evd+yk+ePwdL  k  + +++ ewyfF +rd+ky++g r+nrat+ gyWk+tgkd++v+s +
  AT3G17730.1   6 LPPGFRFHPTDEELVNYYLKRKINGQEIEL-DIIPEVDLYKCEPWDLAeKsFLPSRDPEWYFFGPRDRKYPNGFRTNRATRGGYWKSTGKDRRVTS-Q 101
                  79****************************.99**************84335556888**************************************.9 PP

          NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                  ++++g+kktLv+ykgrap+g +tdWvmheyrl
  AT3G17730.1 102 SRAIGMKKTLVYYKGRAPQGIRTDWVMHEYRL 133
                  99****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.35E-654157IPR003441NAC domain
PROSITE profilePS5100560.8276156IPR003441NAC domain
PfamPF023652.1E-307133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007275Biological Processmulticellular organism development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000293anatomyguard cell
Sequence ? help Back to Top
Protein Sequence    Length: 246 aa     Download sequence    Send to blast
MAPVGLPPGF RFHPTDEELV NYYLKRKING QEIELDIIPE VDLYKCEPWD LAEKSFLPSR  60
DPEWYFFGPR DRKYPNGFRT NRATRGGYWK STGKDRRVTS QSRAIGMKKT LVYYKGRAPQ  120
GIRTDWVMHE YRLDDKDCDD PSSLQDSYAL CRVFKKNGIC SELESERQLQ TGQCSFTTAS  180
MEEINSNNNN NYNNDYETMS PEVGVSSACV EEVVDDKDDS WMQFITDDAW DTSSNGAAMG  240
HGQGVY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A8e-57215711169Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible257863_at0.0
Expression AtlasAT3G17730-
AtGenExpressAT3G17730-
ATTED-IIAT3G17730-
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00363DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G17730.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G17730
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ0565950.0DQ056595.1 Arabidopsis thaliana no apical meristem family protein (At3g17730) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_188400.10.0NAC domain containing protein 57
SwissprotQ9FFI54e-92NAC86_ARATH; NAC domain-containing protein 86
TrEMBLQ9LSH50.0Q9LSH5_ARATH; NAC domain containing protein 57
STRINGAT3G17730.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1715800
MalvidsOGEM85042839
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Ooka H, et al.
    Comprehensive analysis of NAC family genes in Oryza sativa and Arabidopsis thaliana.
    DNA Res., 2003. 10(6): p. 239-47
    [PMID:15029955]
  3. Ditt RF, et al.
    The Arabidopsis thaliana transcriptome in response to Agrobacterium tumefaciens.
    Mol. Plant Microbe Interact., 2006. 19(6): p. 665-81
    [PMID:16776300]