PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G16857.1
Common NameARR1, K20I9.9, MUH15.1, RR1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family ARR-B
Protein Properties Length: 669aa    MW: 72910.5 Da    PI: 6.8326
Description response regulator 1
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G16857.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like90.41.6e-28237290155
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                  kpr++W+ eLH++Fv av+qL G ekA+Pk+ilelm+v+gLt+e+v+SHLQkYR+
  AT3G16857.1 237 KPRVVWSVELHQQFVAAVNQL-GVEKAVPKKILELMNVPGLTRENVASHLQKYRI 290
                  79*******************.********************************7 PP

2Response_reg76.11.3e-25391471109
                   EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTES CS
  Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGak 95 
                   vl+vdD+p+ +++l+++l+   y ev+ +  +e al ll++++  +D+++ D+ mp+mdG++ll++   e  +lp+i+++a ++++ +l+ +  Ga 
   AT3G16857.1  39 VLVVDDDPTCLMILERMLRTCLY-EVTKCNRAEMALSLLRKNKhgFDIVISDVHMPDMDGFKLLEHVGLEM-DLPVIMMSADDSKSVVLKGVTHGAV 133
                   89*********************.***************888889**********************6644.8************************ PP

                   EEEESS--HHHHHH CS
  Response_reg  96 dflsKpfdpeelvk 109
                   d+l Kp+ +e+l +
   AT3G16857.1 134 DYLIKPVRMEALKN 147
                   *********99986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363927.9E-21816669IPR017053Response regulator B-type, plant
SuperFamilySSF521724.41E-3635173IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23002.4E-4136174No hitNo description
SMARTSM004487.4E-3137149IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011042.22138153IPR001789Signal transduction response regulator, receiver domain
PfamPF000727.9E-2339147IPR001789Signal transduction response regulator, receiver domain
CDDcd001565.87E-2840152No hitNo description
PROSITE profilePS5129411.54234293IPR017930Myb domain
SuperFamilySSF466891.59E-19235294IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.9E-30236295IPR009057Homeodomain-like
TIGRFAMsTIGR015573.2E-24237290IPR006447Myb domain, plants
PfamPF002494.3E-8239289IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009414Biological Processresponse to water deprivation
GO:0010082Biological Processregulation of root meristem growth
GO:0010380Biological Processregulation of chlorophyll biosynthetic process
GO:0031537Biological Processregulation of anthocyanin metabolic process
GO:0048367Biological Processshoot system development
GO:0080022Biological Processprimary root development
GO:0080036Biological Processregulation of cytokinin-activated signaling pathway
GO:0080113Biological Processregulation of seed growth
GO:0005634Cellular Componentnucleus
GO:0000156Molecular Functionphosphorelay response regulator activity
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000025anatomyroot tip
PO:0000036anatomyleaf vascular system
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0003000anatomytransition zone
PO:0005660anatomyhydathode
PO:0006079anatomyshoot system meristem
PO:0006339anatomyjuvenile vascular leaf
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0009066anatomyanther
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 669 aa     Download sequence    Send to blast
MMNPSHGRGL GSAGGSSSGR NQGGGGETVV EMFPSGLRVL VVDDDPTCLM ILERMLRTCL  60
YEVTKCNRAE MALSLLRKNK HGFDIVISDV HMPDMDGFKL LEHVGLEMDL PVIMMSADDS  120
KSVVLKGVTH GAVDYLIKPV RMEALKNIWQ HVVRKRRSEW SVPEHSGSIE ETGERQQQQH  180
RGGGGGAAVS GGEDAVDDNS SSVNEGNNWR SSSRKRKDEE GEEQGDDKDE DASNLKKPRV  240
VWSVELHQQF VAAVNQLGVE KAVPKKILEL MNVPGLTREN VASHLQKYRI YLRRLGGVSQ  300
HQGNLNNSFM TGQDASFGPL STLNGFDLQA LAVTGQLPAQ SLAQLQAAGL GRPAMVSKSG  360
LPVSSIVDER SIFSFDNTKT RFGEGLGHHG QQPQQQPQMN LLHGVPTGLQ QQLPMGNRMS  420
IQQQIAAVRA GNSVQNNGML MPLAGQQSLP RGPPPMLTSS QSSIRQPMLS NRISERSGFS  480
GRNNIPESSR VLPTSYTNLT TQHSSSSMPY NNFQPELPVN SFPLASAPGI SVPVRKATSY  540
QEEVNSSEAG FTTPSYDMFT TRQNDWDLRN IGIAFDSHQD SESAAFSASE AYSSSSMSRH  600
NTTVAATEHG RNHQQPPSGM VQHHQVYADG NGGSVRVKSE RVATDTATMA FHEQYSNQED  660
LMSALLKQV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A1e-22236295463ARR10-B
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.486720.0flower| leaf| root| seed
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1865101540.0
Genevisible256790_at0.0
Expression AtlasAT3G16857-
AtGenExpressAT3G16857-
ATTED-IIAT3G16857-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed only from 5 days post germination onward, when the fixed meristem cell number is established. {ECO:0000269|PubMed:17363254}.
UniprotTISSUE SPECIFICITY: Detected in the whole plant. Expressed at the root transition zone (PubMed:17363254). {ECO:0000269|PubMed:15173562, ECO:0000269|PubMed:17363254, ECO:0000269|PubMed:9891419}.
Functional Description ? help Back to Top
Source Description
TAIREncodes an Arabidopsis response regulator (ARR) protein that acts in concert with other type-B ARRs in the cytokinin signaling pathway.
UniProtTranscriptional activator that binds specifically to the DNA sequence 5'-[AG]GATT-3'. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. Could directly activate some type-A response regulators in response to cytokinins. Regulates SHY2 by binding to its promoter (PubMed:19039136). Involved in the root-meristem size determination through the regulation of cell differentiation (PubMed:17363254). {ECO:0000269|PubMed:11574878, ECO:0000269|PubMed:11691951, ECO:0000269|PubMed:17363254, ECO:0000269|PubMed:19039136}.
Function -- GeneRIF ? help Back to Top
  1. arr1-1 mutation clearly affected the primary response in at least 17 genes, meaning that they respond primarily to cytokinins through the function of ARR1
    [PMID: 17202182]
  2. The results of this study suggested that ARR1, ARR10 and ARR12 together play essential (or general) roles in cytokinin signal transduction.
    [PMID: 18037673]
  3. Suppression of pleiotropic cytokinin activities by a dominant repressor version of a B-type ARR indicates that this protein family is involved in mediating most, if not all, of the cytokinin activities.
    [PMID: 18502977]
  4. Results support a model in which cytokinin regulates a wide array of downstream responses through the action of a multistep phosphorelay that culminates in transcriptional regulation by ARR1, ARR10, and ARR12.
    [PMID: 18723577]
  5. ARR1 activates SHY2 gene, repressor of auxin signaling that negatively regulates PIN auxin transport facilitator genes: cytokinin causes auxin redistribution, prompting differentiation; auxin mediates degradation of SHY2, sustaining cell division
    [PMID: 19039136]
  6. Cytokinin regulates sodium homeostasis via ARR1 and ARR12, and acts through ARR1 and ARR12 to regulate AtHKT1;1 expression.
    [PMID: 21105923]
  7. ARR1 mediates cold signal via AHP2 (Arabidopsis histidine kinase 2), AHP3, or AHP5.
    [PMID: 23124324]
  8. A nitrosomimetic mutation of AHP1 causes reduced phosphorylation of AHP1 and ARR1, thereby resulting in a compromised cytokinin response.
    [PMID: 23443557]
  9. Data indicate that one of the immediate early cytokinin response genes is ARR6, which has been shown to be a direct target gene of ARR1, ARR2 and other type-B ARRs.
    [PMID: 23620480]
  10. Data indicate that a family of F-box proteins, called the kiss me deadly (KMD) family KMD1-4, targets type-B ARR proteins (ARR1) for degradation.
    [PMID: 23720308]
  11. Cytokinin signaling increases the abundance of ARR1, a ubiquitously expressed type-B response regulators (RRB), by preventing its degradation by the 26S proteasome.
    [PMID: 24617630]
  12. low temperature inhibits root growth by reducing auxin accumulation via ARR1/12.
    [PMID: 25552473]
  13. The cytokinin module ARABIDOPSIS HISTIDINE KINASE3 (AHK3)/ARABIDOPSIS RESPONSE REGULATOR1 (ARR1)/ARR12 was found to interact with the GR24-dependent reduction in LR development, because mutants in this pathway rendered LR development insensitive to GR24.
    [PMID: 26519957]
  14. SCR mediates ARR1 transcriptional suppression via the RGA protein.
    [PMID: 26848984]
  15. An arr1,10,12 triple mutant had more drought tolerance due to enhanced cell membrane integrity, anthocyanin synthesis, abscissic acid hypersensitivity, and reduced stomatal aperture. Dehydration and ABA repressed all 3 genes. RR1 is the most critical.
    [PMID: 26884175]
  16. Data suggest that shoot removal induces the quantitative and qualitative development of chloroplasts in roots, with cytokinin signaling via RESPONSE REGULATOR (ARR)-ARR1 and ARR12 functioning downstream of wounding signaling to up-regulate genes associated with chloroplast development.
    [PMID: 28193764]
  17. The expression signals of AG were detected in the initiating carpel primordia and regenerating carpels, and co-localized with those of two Type-B ARABIDOPSIS RESPONSE REGULATORs (ARRs), ARR1 and ARR10.
    [PMID: 29186581]
  18. ARR1 role in shoot branching.
    [PMID: 29717021]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G16857.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Down-regulated by gibberellin. {ECO:0000269|PubMed:20605455}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT5G62920(A)
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDcytokinin
Interaction ? help Back to Top
Source Intact With
BioGRIDAT1G53170
IntActSearch Q940D0
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G16857
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3168830.0AK316883.1 Arabidopsis thaliana AT3G16857 mRNA, complete cds, clone: RAFL07-52-A15.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_850600.20.0response regulator 1
SwissprotQ940D00.0ARR1_ARATH; Two-component response regulator ARR1
TrEMBLA0A178VKJ90.0A0A178VKJ9_ARATH; Two-component response regulator
STRINGAT3G16857.20.0(Arabidopsis thaliana)
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Sakai H,Aoyama T,Oka A
    Arabidopsis ARR1 and ARR2 response regulators operate as transcriptional activators.
    Plant J., 2000. 24(6): p. 703-11
    [PMID:11135105]
  3. Suzuki T,Sakurai K,Ueguchi C,Mizuno T
    Two types of putative nuclear factors that physically interact with histidine-containing phosphotransfer (Hpt) domains, signaling mediators in His-to-Asp phosphorelay, in Arabidopsis thaliana.
    Plant Cell Physiol., 2001. 42(1): p. 37-45
    [PMID:11158442]
  4. Hwang I,Sheen J
    Two-component circuitry in Arabidopsis cytokinin signal transduction.
    Nature, 2001. 413(6854): p. 383-9
    [PMID:11574878]
  5. Sakai H, et al.
    ARR1, a transcription factor for genes immediately responsive to cytokinins.
    Science, 2001. 294(5546): p. 1519-21
    [PMID:11691951]
  6. Haberer G,Kieber JJ
    Cytokinins. New insights into a classic phytohormone.
    Plant Physiol., 2002. 128(2): p. 354-62
    [PMID:11842139]
  7. Hutchison CE,Kieber JJ
    Cytokinin signaling in Arabidopsis.
    Plant Cell, 2002. 14 Suppl: p. S47-59
    [PMID:12045269]
  8. Hwang I,Chen HC,Sheen J
    Two-component signal transduction pathways in Arabidopsis.
    Plant Physiol., 2002. 129(2): p. 500-15
    [PMID:12068096]
  9. Che P,Gingerich DJ,Lall S,Howell SH
    Global and hormone-induced gene expression changes during shoot development in Arabidopsis.
    Plant Cell, 2002. 14(11): p. 2771-85
    [PMID:12417700]
  10. Oka A,Sakai H,Iwakoshi S
    His-Asp phosphorelay signal transduction in higher plants: receptors and response regulators for cytokinin signaling in Arabidopsis thaliana.
    Genes Genet. Syst., 2002. 77(6): p. 383-91
    [PMID:12589073]
  11. Imamura A,Kiba T,Tajima Y,Yamashino T,Mizuno T
    In vivo and in vitro characterization of the ARR11 response regulator implicated in the His-to-Asp phosphorelay signal transduction in Arabidopsis thaliana.
    Plant Cell Physiol., 2003. 44(2): p. 122-31
    [PMID:12610214]
  12. Aoyama T,Oka A
    Cytokinin signal transduction in plant cells.
    J. Plant Res., 2003. 116(3): p. 221-31
    [PMID:12836044]
  13. Rashotte AM,Carson SD,To JP,Kieber JJ
    Expression profiling of cytokinin action in Arabidopsis.
    Plant Physiol., 2003. 132(4): p. 1998-2011
    [PMID:12913156]
  14. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  15. Tajima Y, et al.
    Comparative studies on the type-B response regulators revealing their distinctive properties in the His-to-Asp phosphorelay signal transduction of Arabidopsis thaliana.
    Plant Cell Physiol., 2004. 45(1): p. 28-39
    [PMID:14749483]
  16. Tanaka Y,Suzuki T,Yamashino T,Mizuno T
    Comparative studies of the AHP histidine-containing phosphotransmitters implicated in His-to-Asp phosphorelay in Arabidopsis thaliana.
    Biosci. Biotechnol. Biochem., 2004. 68(2): p. 462-5
    [PMID:14981318]
  17. Mason MG,Li J,Mathews DE,Kieber JJ,Schaller GE
    Type-B response regulators display overlapping expression patterns in Arabidopsis.
    Plant Physiol., 2004. 135(2): p. 927-37
    [PMID:15173562]
  18. Ross EJ, et al.
    Activation of the Oryza sativa non-symbiotic haemoglobin-2 promoter by the cytokinin-regulated transcription factor, ARR1.
    J. Exp. Bot., 2004. 55(403): p. 1721-31
    [PMID:15258171]
  19. Bürkle L,Meyer S,Dortay H,Lehrach H,Heyl A
    In vitro recombination cloning of entire cDNA libraries in Arabidopsis thaliana and its application to the yeast two-hybrid system.
    Funct. Integr. Genomics, 2005. 5(3): p. 175-83
    [PMID:15714319]
  20. Mason MG, et al.
    Multiple type-B response regulators mediate cytokinin signal transduction in Arabidopsis.
    Plant Cell, 2005. 17(11): p. 3007-18
    [PMID:16227453]
  21. Dortay H,Mehnert N,B
    Analysis of protein interactions within the cytokinin-signaling pathway of Arabidopsis thaliana.
    FEBS J., 2006. 273(20): p. 4631-44
    [PMID:16965536]
  22. Yokoyama A, et al.
    Type-B ARR transcription factors, ARR10 and ARR12, are implicated in cytokinin-mediated regulation of protoxylem differentiation in roots of Arabidopsis thaliana.
    Plant Cell Physiol., 2007. 48(1): p. 84-96
    [PMID:17132632]
  23. Taniguchi M,Sasaki N,Tsuge T,Aoyama T,Oka A
    ARR1 directly activates cytokinin response genes that encode proteins with diverse regulatory functions.
    Plant Cell Physiol., 2007. 48(2): p. 263-77
    [PMID:17202182]
  24. Dello Ioio R, et al.
    Cytokinins determine Arabidopsis root-meristem size by controlling cell differentiation.
    Curr. Biol., 2007. 17(8): p. 678-82
    [PMID:17363254]
  25. Ishida K,Yamashino T,Yokoyama A,Mizuno T
    Three type-B response regulators, ARR1, ARR10 and ARR12, play essential but redundant roles in cytokinin signal transduction throughout the life cycle of Arabidopsis thaliana.
    Plant Cell Physiol., 2008. 49(1): p. 47-57
    [PMID:18037673]
  26. Heyl A, et al.
    The transcriptional repressor ARR1-SRDX suppresses pleiotropic cytokinin activities in Arabidopsis.
    Plant Physiol., 2008. 147(3): p. 1380-95
    [PMID:18502977]
  27. Manzano C,Abraham Z,L
    Identification of ubiquitinated proteins in Arabidopsis.
    Plant Mol. Biol., 2008. 68(1-2): p. 145-58
    [PMID:18535787]
  28. Dortay H, et al.
    Toward an interaction map of the two-component signaling pathway of Arabidopsis thaliana.
    J. Proteome Res., 2008. 7(9): p. 3649-60
    [PMID:18642946]
  29. Ascencio-Ib
    Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection.
    Plant Physiol., 2008. 148(1): p. 436-54
    [PMID:18650403]
  30. Argyros RD, et al.
    Type B response regulators of Arabidopsis play key roles in cytokinin signaling and plant development.
    Plant Cell, 2008. 20(8): p. 2102-16
    [PMID:18723577]
  31. Dello Ioio R, et al.
    A genetic framework for the control of cell division and differentiation in the root meristem.
    Science, 2008. 322(5906): p. 1380-4
    [PMID:19039136]
  32. Moubayidin L, et al.
    The rate of cell differentiation controls the Arabidopsis root meristem growth phase.
    Curr. Biol., 2010. 20(12): p. 1138-43
    [PMID:20605455]
  33. Perochon A, et al.
    Interaction of a plant pseudo-response regulator with a calmodulin-like protein.
    Biochem. Biophys. Res. Commun., 2010. 398(4): p. 747-51
    [PMID:20627089]
  34. Mason MG, et al.
    Type-B response regulators ARR1 and ARR12 regulate expression of AtHKT1;1 and accumulation of sodium in Arabidopsis shoots.
    Plant J., 2010. 64(5): p. 753-63
    [PMID:21105923]
  35. Zhou ZY, et al.
    Functional characterization of the CKRC1/TAA1 gene and dissection of hormonal actions in the Arabidopsis root.
    Plant J., 2011. 66(3): p. 516-27
    [PMID:21255165]
  36. Nemoto K, et al.
    Autophosphorylation profiling of Arabidopsis protein kinases using the cell-free system.
    Phytochemistry, 2011. 72(10): p. 1136-44
    [PMID:21477822]
  37. Zheng X, et al.
    AUXIN UP-REGULATED F-BOX PROTEIN1 regulates the cross talk between auxin transport and cytokinin signaling during plant root growth.
    Plant Physiol., 2011. 156(4): p. 1878-93
    [PMID:21653785]
  38. Kushwah S,Jones AM,Laxmi A
    Cytokinin interplay with ethylene, auxin, and glucose signaling controls Arabidopsis seedling root directional growth.
    Plant Physiol., 2011. 156(4): p. 1851-66
    [PMID:21666052]
  39. Cutcliffe JW,Hellmann E,Heyl A,Rashotte AM
    CRFs form protein-protein interactions with each other and with members of the cytokinin signalling pathway in Arabidopsis via the CRF domain.
    J. Exp. Bot., 2011. 62(14): p. 4995-5002
    [PMID:21705390]
  40. Klopffleisch K, et al.
    Arabidopsis G-protein interactome reveals connections to cell wall carbohydrates and morphogenesis.
    Mol. Syst. Biol., 2011. 7: p. 532
    [PMID:21952135]
  41. Wang J,Ma XM,Kojima M,Sakakibara H,Hou BK
    N-glucosyltransferase UGT76C2 is involved in cytokinin homeostasis and cytokinin response in Arabidopsis thaliana.
    Plant Cell Physiol., 2011. 52(12): p. 2200-13
    [PMID:22051886]
  42. Das PK, et al.
    Cytokinins enhance sugar-induced anthocyanin biosynthesis in Arabidopsis.
    Mol. Cells, 2012. 34(1): p. 93-101
    [PMID:22699753]
  43. Jeon J,Kim J
    Arabidopsis response Regulator1 and Arabidopsis histidine phosphotransfer Protein2 (AHP2), AHP3, and AHP5 function in cold signaling.
    Plant Physiol., 2013. 161(1): p. 408-24
    [PMID:23124324]
  44. Wang J,Ma XM,Kojima M,Sakakibara H,Hou BK
    Glucosyltransferase UGT76C1 finely modulates cytokinin responses via cytokinin N-glucosylation in Arabidopsis thaliana.
    Plant Physiol. Biochem., 2013. 65: p. 9-16
    [PMID:23416491]
  45. Feng J, et al.
    S-nitrosylation of phosphotransfer proteins represses cytokinin signaling.
    Nat Commun, 2013. 4: p. 1529
    [PMID:23443557]
  46. Hill K, et al.
    Functional characterization of type-B response regulators in the Arabidopsis cytokinin response.
    Plant Physiol., 2013. 162(1): p. 212-24
    [PMID:23482873]
  47. Ramireddy E,Brenner WG,Pfeifer A,Heyl A,Schm
    In planta analysis of a cis-regulatory cytokinin response motif in Arabidopsis and identification of a novel enhancer sequence.
    Plant Cell Physiol., 2013. 54(7): p. 1079-92
    [PMID:23620480]
  48. Kim HJ,Chiang YH,Kieber JJ,Schaller GE
    SCF(KMD) controls cytokinin signaling by regulating the degradation of type-B response regulators.
    Proc. Natl. Acad. Sci. U.S.A., 2013. 110(24): p. 10028-33
    [PMID:23720308]
  49. Moubayidin L, et al.
    Spatial coordination between stem cell activity and cell differentiation in the root meristem.
    Dev. Cell, 2013. 26(4): p. 405-15
    [PMID:23987513]
  50. Takahashi N, et al.
    Cytokinins control endocycle onset by promoting the expression of an APC/C activator in Arabidopsis roots.
    Curr. Biol., 2013. 23(18): p. 1812-7
    [PMID:24035544]
  51. Kurepa J,Li Y,Perry SE,Smalle JA
    Ectopic expression of the phosphomimic mutant version of Arabidopsis response regulator 1 promotes a constitutive cytokinin response phenotype.
    BMC Plant Biol., 2014. 14: p. 28
    [PMID:24423196]
  52. Cortleven A, et al.
    A novel protective function for cytokinin in the light stress response is mediated by the Arabidopsis histidine kinase2 and Arabidopsis histidine kinase3 receptors.
    Plant Physiol., 2014. 164(3): p. 1470-83
    [PMID:24424319]
  53. Kurepa J,Li Y,Smalle JA
    Cytokinin signaling stabilizes the response activator ARR1.
    Plant J., 2014. 78(1): p. 157-68
    [PMID:24617630]
  54. Zhu J, et al.
    Low temperature inhibits root growth by reducing auxin accumulation via ARR1/12.
    Plant Cell Physiol., 2015. 56(4): p. 727-36
    [PMID:25552473]
  55. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]
  56. Marín-de la Rosa N, et al.
    Genome Wide Binding Site Analysis Reveals Transcriptional Coactivation of Cytokinin-Responsive Genes by DELLA Proteins.
    PLoS Genet., 2015. 11(7): p. e1005337
    [PMID:26134422]
  57. D'Alessandro S,Golin S,Hardtke CS,Lo Schiavo F,Zottini M
    The co-chaperone p23 controls root development through the modulation of auxin distribution in the Arabidopsis root meristem.
    J. Exp. Bot., 2015. 66(16): p. 5113-22
    [PMID:26163704]
  58. Jiang L, et al.
    Strigolactones spatially influence lateral root development through the cytokinin signaling network.
    J. Exp. Bot., 2016. 67(1): p. 379-89
    [PMID:26519957]
  59. Moubayidin L, et al.
    A SCARECROW-based regulatory circuit controls Arabidopsis thaliana meristem size from the root endodermis.
    Planta, 2016. 243(5): p. 1159-68
    [PMID:26848984]
  60. Nguyen KH, et al.
    Arabidopsis type B cytokinin response regulators ARR1, ARR10, and ARR12 negatively regulate plant responses to drought.
    Proc. Natl. Acad. Sci. U.S.A., 2016. 113(11): p. 3090-5
    [PMID:26884175]
  61. Muraro D, et al.
    A multi-scale model of the interplay between cell signalling and hormone transport in specifying the root meristem of Arabidopsis thaliana.
    J. Theor. Biol., 2016. 404: p. 182-205
    [PMID:27157127]
  62. Cortleven A, et al.
    Cytokinin Regulates the Etioplast-Chloroplast Transition through the Two-Component Signaling System and Activation of Chloroplast-Related Genes.
    Plant Physiol., 2016. 172(1): p. 464-78
    [PMID:27388681]
  63. Kobayashi K, et al.
    Shoot Removal Induces Chloroplast Development in Roots via Cytokinin Signaling.
    Plant Physiol., 2017. 173(4): p. 2340-2355
    [PMID:28193764]
  64. Zhang TQ, et al.
    A Two-Step Model for de Novo Activation of WUSCHEL during Plant Shoot Regeneration.
    Plant Cell, 2017. 29(5): p. 1073-1087
    [PMID:28389585]
  65. Kushwah S,Laxmi A
    The interaction between glucose and cytokinin signaling in controlling Arabidopsis thaliana seedling root growth and development.
    Plant Signal Behav, 2017. 12(5): p. e1312241
    [PMID:28467152]
  66. Meng WJ, et al.
    Type-B ARABIDOPSIS RESPONSE REGULATORs Specify the Shoot Stem Cell Niche by Dual Regulation of WUSCHEL.
    Plant Cell, 2017. 29(6): p. 1357-1372
    [PMID:28576846]
  67. Kobayashi K,Iwase A
    Simultaneous but spatially different regulation of non-photosynthetic callus formation and photosynthetic root development after shoot removal.
    Plant Signal Behav, 2017. 12(6): p. e1338999
    [PMID:28594268]
  68. Liu B,De Storme N,Geelen D
    Cold interferes with male meiotic cytokinesis in Arabidopsis thaliana independently of the AHK2/3-AHP2/3/5 cytokinin signaling module.
    Cell Biol. Int., 2017. 41(8): p. 879-889
    [PMID:28618065]
  69. Zhang F,May A,Irish VF
    Type-B ARABIDOPSIS RESPONSE REGULATORs Directly Activate WUSCHEL.
    Trends Plant Sci., 2017. 22(10): p. 815-817
    [PMID:28886911]
  70. Yan Z, et al.
    Type B Response Regulators Act As Central Integrators in Transcriptional Control of the Auxin Biosynthesis Enzyme TAA1.
    Plant Physiol., 2017. 175(3): p. 1438-1454
    [PMID:28931628]
  71. Rong XF, et al.
    Type-B ARRs Control Carpel Regeneration Through Mediating AGAMOUS Expression in Arabidopsis.
    Plant Cell Physiol., 2018. 59(4): p. 756-764
    [PMID:29186581]
  72. Bustillo-Avendaño E, et al.
    Regulation of Hormonal Control, Cell Reprogramming, and Patterning during De Novo Root Organogenesis.
    Plant Physiol., 2018. 176(2): p. 1709-1727
    [PMID:29233938]
  73. Waldie T,Leyser O
    Cytokinin Targets Auxin Transport to Promote Shoot Branching.
    Plant Physiol., 2018. 177(2): p. 803-818
    [PMID:29717021]
  74. Sakai H,Aoyama T,Bono H,Oka A
    Two-component response regulators from Arabidopsis thaliana contain a putative DNA-binding motif.
    Plant Cell Physiol., 1998. 39(11): p. 1232-9
    [PMID:9891419]