PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G16350.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB_related
Protein Properties Length: 387aa    MW: 41190.6 Da    PI: 9.1979
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G16350.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.61.4e-13138182347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ l++ + ++lG+g+W+ I+r   + Rt+ q+ s+ qky
      AT3G16350.1 138 PWTEEEHRLFLVGLQKLGKGDWRGISRNYVTSRTPTQVASHAQKY 182
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.581131187IPR017930Myb domain
SuperFamilySSF466898.22E-17133187IPR009057Homeodomain-like
TIGRFAMsTIGR015577.1E-18134185IPR006447Myb domain, plants
SMARTSM007171.7E-10135185IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.2E-11137181IPR009057Homeodomain-like
PfamPF002494.8E-11138182IPR001005SANT/Myb domain
CDDcd001673.34E-9138183No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000084anatomyplant sperm cell
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025195anatomypollen tube cell
PO:0025281anatomypollen
PO:0001016developmental stageL mature pollen stage
PO:0001017developmental stageM germinated pollen stage
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 387 aa     Download sequence    Send to blast
MTRRCSHCSN NGHNSRTCPT RGGGTCGGSG GGGGGGGGGG SGSSSAVKLF GVRLTDGSII  60
KKSASMGNLS ALAVAAAAAT HHRLSPSSPL ATSNLNDSPL SDHARYSNLH HNEGYLSDDP  120
AHGSGSSHRR GERKRGVPWT EEEHRLFLVG LQKLGKGDWR GISRNYVTSR TPTQVASHAQ  180
KYFIRHTSSS RRKRRSSLFD MVTDEMVTDS SPTQEEQTLN GSSPSKEPEK KSYLPSLELS  240
LNNTTEAEEV VATAPRQEKS QEAIEPSNGV SPMLVPGGFF PPCFPVTYTI WLPASLHGTE  300
HALNAETSSQ QHQVLKPKPG FAKERVNMDE LVGMSQLSIG MATRHETETS PSPLSLRLEP  360
SRPSAFHSNG SVNGADLSKG NSAIQAI
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12840SGGGGGGGGGGGS
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.476780.0root
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO425642540.0
Genevisible259379_at0.0
Expression AtlasAT3G16350-
AtGenExpressAT3G16350-
ATTED-IIAT3G16350-
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G16350.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDauxin, ethylene, gibberellin, jasmonic acid
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G16350
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0058320.0BT005832.1 Arabidopsis thaliana At3g16350 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_188256.10.0Homeodomain-like superfamily protein
TrEMBLA0A384KSV50.0A0A384KSV5_ARATH; Uncharacterized protein
TrEMBLQ84TG20.0Q84TG2_ARATH; At3g16350
STRINGAT3G16350.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM93132735
Representative plantOGRP3941699
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Dal Bosco C, et al.
    Inactivation of the chloroplast ATP synthase gamma subunit results in high non-photochemical fluorescence quenching and altered nuclear gene expression in Arabidopsis thaliana.
    J. Biol. Chem., 2004. 279(2): p. 1060-9
    [PMID:14576160]
  3. Wang XJ,Cao XL,Hong Y
    Isolation and characterization of flower-specific transcripts in Acacia mangium.
    Tree Physiol., 2005. 25(2): p. 167-78
    [PMID:15574398]
  4. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  5. Wang Y, et al.
    Transcriptome analyses show changes in gene expression to accompany pollen germination and tube growth in Arabidopsis.
    Plant Physiol., 2008. 148(3): p. 1201-11
    [PMID:18775970]
  6. Ikeda M,Ohme-Takagi M
    A novel group of transcriptional repressors in Arabidopsis.
    Plant Cell Physiol., 2009. 50(5): p. 970-5
    [PMID:19324928]
  7. Causier B,Ashworth M,Guo W,Davies B
    The TOPLESS interactome: a framework for gene repression in Arabidopsis.
    Plant Physiol., 2012. 158(1): p. 423-38
    [PMID:22065421]