PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G16160.1
Common NameMSL1.20, TCX8
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family CPP
Protein Properties Length: 368aa    MW: 41199.7 Da    PI: 7.0597
Description Tesmin/TSO1-like CXC domain-containing protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G16160.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR48.41.8e-1564102241
          TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41 
                  ++kgC+Ck+skClk+YC+Cfa+g+ C++ C C dC+N++e
  AT3G16160.1  64 KHKGCRCKQSKCLKLYCDCFASGVVCTD-CDCVDCHNNSE 102
                  789*************************.********987 PP

2TCR49.68e-16148185441
          TCR   4 kgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41 
                  +gC+Ck+++ClkkYCeCf+a+  Cs++CkC +CkN +e
  AT3G16160.1 148 RGCKCKRTRCLKKYCECFQANLLCSDNCKCINCKNVSE 185
                  79*********************************875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011143.4E-1763103IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163430.01964185IPR005172CRC domain
PfamPF036381.5E-1266100IPR005172CRC domain
SMARTSM011144.2E-17145186IPR033467Tesmin/TSO1-like CXC domain
PfamPF036382.7E-12148183IPR005172CRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007275Biological Processmulticellular organism development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046872Molecular Functionmetal ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 368 aa     Download sequence    Send to blast
MTGNADSGKI ATEKDPRKLV FTKLEVSPVF RESPVKELPL FPPISREHSE AKDKTDEEGI  60
TSRKHKGCRC KQSKCLKLYC DCFASGVVCT DCDCVDCHNN SEKCDAREAA MVNVLGRNPN  120
AFSEKALGSL TDNQCKAAPD TKPGLLSRGC KCKRTRCLKK YCECFQANLL CSDNCKCINC  180
KNVSEAFQPP AFSAHNSPQV YRRRRDRELT EWNSCPAPLF SIPDNSIQNA LGSPMSCSPK  240
LPYRKKRSLM GYTSTLLPDL GDLCSLLVAA SESATTTAED QNRIFTKPDD KEAIELSSES  300
ESRNVEEEIQ SRGRLIELID VQYNGEEDSQ CKTKTSVNET DIYMEQERAV LETFRDCLQK  360
FIKSRLES
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A2e-18611867124Protein lin-54 homolog
5fd3_B2e-18611867124Protein lin-54 homolog
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO794036460.0
Genevisible257538_at0.0
Expression AtlasAT3G16160-
AtGenExpressAT3G16160-
ATTED-IIAT3G16160-
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G16160.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G16160
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ6530890.0DQ653089.1 Arabidopsis thaliana clone 0000013135_0000009456 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_188237.20.0Tesmin/TSO1-like CXC domain-containing protein
SwissprotQ700D00.0TCX8_ARATH; Protein tesmin/TSO1-like CXC 8
TrEMBLA0A178VJW10.0A0A178VJW1_ARATH; Uncharacterized protein
STRINGAT3G16160.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM148441520
Representative plantOGRP14691745
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Gong W, et al.
    Genome-wide ORFeome cloning and analysis of Arabidopsis transcription factor genes.
    Plant Physiol., 2004. 135(2): p. 773-82
    [PMID:15208423]
  3. Underwood BA,Vanderhaeghen R,Whitford R,Town CD,Hilson P
    Simultaneous high-throughput recombinational cloning of open reading frames in closed and open configurations.
    Plant Biotechnol. J., 2006. 4(3): p. 317-24
    [PMID:17147637]
  4. Andersen SU, et al.
    The conserved cysteine-rich domain of a tesmin/TSO1-like protein binds zinc in vitro and TSO1 is required for both male and female fertility in Arabidopsis thaliana.
    J. Exp. Bot., 2007. 58(13): p. 3657-70
    [PMID:18057042]