PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G15510.1
Common NameANAC056, ATNAC2, MJK13.17, NAC056, NAC2, NARS1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 364aa    MW: 40026.8 Da    PI: 7.7448
Description NAC domain containing protein 2
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G15510.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM172.99.7e-54171441128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kg 97 
                  lppGfrFhPtdeelvv+yLk+k+++ +l++  +i+evd+yk++Pw+Lp+k++ +e+ewyfFs+rd+ky++g r+nra++sgyWkatg+dk+vl++ ++
  AT3G15510.1  17 LPPGFRFHPTDEELVVHYLKRKAASAPLPV-AIIAEVDLYKFDPWELPAKASFGEQEWYFFSPRDRKYPNGARPNRAATSGYWKATGTDKPVLASdGN 113
                  79****************************.88***************999999***************************************99677 PP

          NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                  ++vg+kk Lvfy+g+ pkg+k+dW+mheyrl
  AT3G15510.1 114 QKVGVKKALVFYSGKPPKGVKSDWIMHEYRL 144
                  88***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.53E-6512178IPR003441NAC domain
PROSITE profilePS5100562.12317178IPR003441NAC domain
PfamPF023657.4E-2818144IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009753Biological Processresponse to jasmonic acid
GO:0045995Biological Processregulation of embryonic development
GO:0048317Biological Processseed morphogenesis
GO:0080060Biological Processintegument development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0009005anatomyroot
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0020030anatomycotyledon
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 364 aa     Download sequence    Send to blast
MESTDSSGGP PPPQPNLPPG FRFHPTDEEL VVHYLKRKAA SAPLPVAIIA EVDLYKFDPW  60
ELPAKASFGE QEWYFFSPRD RKYPNGARPN RAATSGYWKA TGTDKPVLAS DGNQKVGVKK  120
ALVFYSGKPP KGVKSDWIMH EYRLIENKPN NRPPGCDFGN KKNSLRLDDW VLCRIYKKNN  180
ASRHVDNDKD HDMIDYIFRK IPPSLSMAAA STGLHQHHHN VSRSMNFFPG KFSGGGYGIF  240
SDGGNTSIYD GGGMINNIGT DSVDHDNNAD VVGLNHASSS GPMMMANLKR TLPVPYWPVA  300
DEEQDASPSK RFHGVGGGGG DCSNMSSSMM EETPPLMQQQ GGVLGDGLFR TTSYQLPGLN  360
WYSS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B6e-751118311170NAC domain-containing protein 19
4dul_A6e-751118311170NAC domain-containing protein 19
1ut7_B6e-751118311170NO APICAL MERISTEM PROTEIN
1ut7_A6e-751118311170NO APICAL MERISTEM PROTEIN
1ut4_B6e-751118311170NO APICAL MERISTEM PROTEIN
1ut4_A6e-751118311170NO APICAL MERISTEM PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.104890.0seed| silique
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible258385_at0.0
Expression AtlasAT3G15510-
AtGenExpressAT3G15510-
ATTED-IIAT3G15510-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed throughout anthers from stages 8 to 12. Later confined to distal region of anthers from stage 13. {ECO:0000269|PubMed:16055634}.
UniprotTISSUE SPECIFICITY: Stamen specific, in anthers from stage 8 (PubMed:15100403, PubMed:16055634). Expressed in the outer integument, but seems not expressed in the embryo at the torpedo stage (PubMed:18849494). {ECO:0000269|PubMed:15100403, ECO:0000269|PubMed:16055634, ECO:0000269|PubMed:18849494}.
Functional Description ? help Back to Top
Source Description
TAIRNote of caution: not to be confused with another protein (AtNAC6 locus AT5G39610) which on occasion has also been referred to as AtNAC2.
UniProtTranscription factor of the NAC family (Probable). Together with NAC018/NARS2, regulates embryogenesis by regulating the development and degeneration of ovule integuments, a process required for intertissue communication between the embryo and the maternal integument (PubMed:18849494). {ECO:0000269|PubMed:18849494, ECO:0000305}.
Function -- GeneRIF ? help Back to Top
  1. AtNAC2 may be a transcription factor incorporating the environmental and endogenous stimuli into the process of plant lateral root development.
    [PMID: 16359384]
  2. NARS1/NAC2 and NARS2/NAM regulate embryogenesis by regulating the development and degeneration of ovule integuments.
    [PMID: 18849494]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00361DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G15510.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By Jasmonic acid (JA). {ECO:0000269|PubMed:16805732}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT1G11840(A), AT4G33150(R)
Interaction ? help Back to Top
Source Intact With
BioGRIDAT1G14920
Phenotype -- Disruption Phenotype ? help Back to Top
Source Description
UniProtDISRUPTION PHENOTYPE: When associated with disruption in NAC018/NARS2, abnormally shaped seeds, defect in embryogenesis sometimes arrested at the torpedo-shaped embryo stage thus leading to partial embryonic lethality, markedly delayed integuments degeneration, and delay of silique senescence. {ECO:0000269|PubMed:18849494}.
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G15510
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0050440.0BT005044.1 Arabidopsis thaliana clone U20756 putative jasmonic acid regulatory protein (At3g15510) mRNA, complete cds.
GenBankBT0040790.0BT004079.1 Arabidopsis thaliana clone RAFL15-22-L08 (R20756) putative jasmonic acid regulatory protein (At3g15510) mRNA, complete cds.
GenBankAB0490710.0AB049071.1 Arabidopsis thaliana AtNAC2 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_188170.10.0NAC domain containing protein 2
SwissprotQ9LD440.0NAC56_ARATH; NAC transcription factor 56
TrEMBLD7L4U40.0D7L4U4_ARALL; ATNAC2
STRINGAT3G15510.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1715800
MalvidsOGEM19028276
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Takada S,Hibara K,Ishida T,Tasaka M
    The CUP-SHAPED COTYLEDON1 gene of Arabidopsis regulates shoot apical meristem formation.
    Development, 2001. 128(7): p. 1127-35
    [PMID:11245578]
  3. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  4. Jiao Y, et al.
    A genome-wide analysis of blue-light regulation of Arabidopsis transcription factor gene expression during seedling development.
    Plant Physiol., 2003. 133(4): p. 1480-93
    [PMID:14605227]
  5. Ooka H, et al.
    Comprehensive analysis of NAC family genes in Oryza sativa and Arabidopsis thaliana.
    DNA Res., 2003. 10(6): p. 239-47
    [PMID:15029955]
  6. Wellmer F,Riechmann JL,Alves-Ferreira M,Meyerowitz EM
    Genome-wide analysis of spatial gene expression in Arabidopsis flowers.
    Plant Cell, 2004. 16(5): p. 1314-26
    [PMID:15100403]
  7. Nakayama N, et al.
    Gene trap lines define domains of gene regulation in Arabidopsis petals and stamens.
    Plant Cell, 2005. 17(9): p. 2486-506
    [PMID:16055634]
  8. He XJ, et al.
    AtNAC2, a transcription factor downstream of ethylene and auxin signaling pathways, is involved in salt stress response and lateral root development.
    Plant J., 2005. 44(6): p. 903-16
    [PMID:16359384]
  9. Zhou HL, et al.
    Roles of ethylene receptor NTHK1 domains in plant growth, stress response and protein phosphorylation.
    FEBS Lett., 2006. 580(5): p. 1239-50
    [PMID:16442528]
  10. Mandaokar A, et al.
    Transcriptional regulators of stamen development in Arabidopsis identified by transcriptional profiling.
    Plant J., 2006. 46(6): p. 984-1008
    [PMID:16805732]
  11. Kunieda T, et al.
    NAC family proteins NARS1/NAC2 and NARS2/NAM in the outer integument regulate embryogenesis in Arabidopsis.
    Plant Cell, 2008. 20(10): p. 2631-42
    [PMID:18849494]
  12. Chen T, et al.
    Effects of tobacco ethylene receptor mutations on receptor kinase activity, plant growth and stress responses.
    Plant Cell Physiol., 2009. 50(9): p. 1636-50
    [PMID:19608714]
  13. Balazadeh S, et al.
    A gene regulatory network controlled by the NAC transcription factor ANAC092/AtNAC2/ORE1 during salt-promoted senescence.
    Plant J., 2010. 62(2): p. 250-64
    [PMID:20113437]
  14. Gaudinier A, et al.
    Enhanced Y1H assays for Arabidopsis.
    Nat. Methods, 2011. 8(12): p. 1053-5
    [PMID:22037706]
  15. Aslam M, et al.
    Isolation and characterization of cold responsive NAC gene from Lepidium latifolium.
    Mol. Biol. Rep., 2012. 39(10): p. 9629-38
    [PMID:22733493]
  16. Mar
    Large-scale identification of gibberellin-related transcription factors defines group VII ETHYLENE RESPONSE FACTORS as functional DELLA partners.
    Plant Physiol., 2014. 166(2): p. 1022-32
    [PMID:25118255]
  17. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]