PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G14020.1
Common NameMDC16.15, NFYA6, NF-YA6
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NF-YA
Protein Properties Length: 308aa    MW: 34433.5 Da    PI: 9.9528
Description nuclear factor Y, subunit A6
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G14020.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA101.11.1e-31170226158
    CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                  +ep++VNaKQyq+Il+RR++Rakle+++kl +k rkpylheSRh hAl+R RgsgGrF
  AT3G14020.1 170 NEPIFVNAKQYQAILRRRERRAKLEAQNKL-IKVRKPYLHESRHLHALKRVRGSGGRF 226
                  59****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005211.0E-35168229IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115236.271169229IPR001289Nuclear transcription factor Y subunit A
PfamPF020452.7E-26171226IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006163.2E-22172194IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860174194IPR018362CCAAT-binding factor, conserved site
PRINTSPR006163.2E-22203226IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010262Biological Processsomatic embryogenesis
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MQEFHSSKDS LPCPATSWDN SVFTNSNVQG SSSLTDNNTL SLTMEMKQTG FQMQHYDSSS  60
TQSTGGESYS EVASLSEPTN RYGHNIVVTH LSGYKENPEN PIGSHSISKV SQDSVVLPIE  120
AASWPLHGNV TPHFNGFLSF PYASQHTVQH PQIRGLVPSR MPLPHNIPEN EPIFVNAKQY  180
QAILRRRERR AKLEAQNKLI KVRKPYLHES RHLHALKRVR GSGGRFLNTK KHQESNSSLS  240
PPFLIPPHVF KNSPGKFRQM DISRGGVVSS VSTTSCSDIT GNNNDMFQQN PQFRFSGYPS  300
NHHVSVLM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A6e-18171241377NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO3341853320.0
Genevisible258198_at0.0
Expression AtlasAT3G14020-
AtGenExpressAT3G14020-
ATTED-IIAT3G14020-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in flowers and siliques. {ECO:0000269|PubMed:11250072}.
Functional Description ? help Back to Top
Source Description
UniProtStimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}.
Function -- GeneRIF ? help Back to Top
  1. these results provide evidence that NF-YA1, 5, 6, and 9 play redundant roles in male gametophyte development, embryogenesis, seed development, and post-germinative growth.
    [PMID: 22933713]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G14020.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
BioGRIDAT5G47640, AT1G54830
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G14020
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4936130.0AB493613.1 Arabidopsis thaliana At3g14020 mRNA for hypothetical protein, partial cds, clone: RAAt3g14020.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001327488.10.0nuclear factor Y, subunit A6
RefseqNP_188018.10.0nuclear factor Y, subunit A6
SwissprotQ9LVJ70.0NFYA6_ARATH; Nuclear transcription factor Y subunit A-6
TrEMBLA0A178V9U20.0A0A178V9U2_ARATH; NF-YA6
STRINGAT3G14020.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM147331620
Representative plantOGRP6801672
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Gusmaroli G,Tonelli C,Mantovani R
    Regulation of the CCAAT-Binding NF-Y subunits in Arabidopsis thaliana.
    Gene, 2001. 264(2): p. 173-85
    [PMID:11250072]
  3. Gusmaroli G,Tonelli C,Mantovani R
    Regulation of novel members of the Arabidopsis thaliana CCAAT-binding nuclear factor Y subunits.
    Gene, 2002. 283(1-2): p. 41-8
    [PMID:11867211]
  4. Dal Bosco C, et al.
    Inactivation of the chloroplast ATP synthase gamma subunit results in high non-photochemical fluorescence quenching and altered nuclear gene expression in Arabidopsis thaliana.
    J. Biol. Chem., 2004. 279(2): p. 1060-9
    [PMID:14576160]
  5. Hackenberg D, et al.
    Studies on differential nuclear translocation mechanism and assembly of the three subunits of the Arabidopsis thaliana transcription factor NF-Y.
    Mol Plant, 2012. 5(4): p. 876-88
    [PMID:22199235]
  6. Calvenzani V, et al.
    Interactions and CCAAT-binding of Arabidopsis thaliana NF-Y subunits.
    PLoS ONE, 2012. 7(8): p. e42902
    [PMID:22912760]
  7. Mu J,Tan H,Hong S,Liang Y,Zuo J
    Arabidopsis transcription factor genes NF-YA1, 5, 6, and 9 play redundant roles in male gametogenesis, embryogenesis, and seed development.
    Mol Plant, 2013. 6(1): p. 188-201
    [PMID:22933713]
  8. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  9. Zhao H, et al.
    The Arabidopsis thaliana Nuclear Factor Y Transcription Factors.
    Front Plant Sci, 2016. 7: p. 2045
    [PMID:28119722]