PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G13960.1
Common NameAtGRF5, GRF5, MDC16.8
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family GRF
Protein Properties Length: 397aa    MW: 44695.6 Da    PI: 8.2019
Description growth-regulating factor 5
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G13960.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC76.42.9e-2481125145
          WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                  d+epgrCrRtDGKkWRCsr++++++k+CE+H+hrgr+r rks ++
  AT3G13960.1  81 DPEPGRCRRTDGKKWRCSREAYPDSKYCEKHMHRGRNRARKSLDQ 125
                  79***************************************9875 PP

2QLQ62.21.3e-211651237
          QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37
                 +FT++Q+++L++Q+l+yKy+++++PvPpeL++ i++
  AT3G13960.1 16 PFTPTQWEELEHQALIYKYMVSGVPVPPELIFSIRR 51
                 9*******************************9985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009514.4E-141551IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088807.6E-161650IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166623.4161651IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.29781125IPR014977WRC domain
PfamPF088791.8E-2082122IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009739Biological Processresponse to gibberellin
GO:0030912Biological Processresponse to deep water
GO:0048366Biological Processleaf development
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000037anatomyshoot apex
PO:0009005anatomyroot
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009052anatomyflower pedicel
PO:0020144anatomyapical meristem
PO:0025022anatomycollective leaf structure
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 397 aa     Download sequence    Send to blast
MMSLSGSSGR TIGRPPFTPT QWEELEHQAL IYKYMVSGVP VPPELIFSIR RSLDTSLVSR  60
LLPHQSLGWG CYQMGFGRKP DPEPGRCRRT DGKKWRCSRE AYPDSKYCEK HMHRGRNRAR  120
KSLDQNQTTT TPLTSPSLSF TNNNNPSPTL SSSSSSNSSS TTYSASSSSM DAYSNSNRFG  180
LGGSSSNTRG YFNSHSLDYP YPSTSPKQQQ QTLHHASALS LHQNTNSTSQ FNVLASATDH  240
KDFRYFQGIG ERVGGVGERT FFPEASRSFQ DSPYHHHQQP LATVMNDPYH HCSTDHNKID  300
HHHTYSSSSS SQHLHHDHDH RQQQCFVLGA DMFNKPTRSV LANSSRQDQN QEEDEKDSSE  360
SSKKSLHHFF GEDWAQNKNS SDSWLDLSSH SRLDTGS
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.434140.0flower| seed
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible258204_at0.0
Expression AtlasAT3G13960-
AtGenExpressAT3G13960-
ATTED-IIAT3G13960-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed during the early stages of leaf development and expression decreases with the maturation of the leaf. {ECO:0000269|PubMed:20023165}.
UniprotTISSUE SPECIFICITY: Strongly expressed in actively growing and developing tissues, such as roots, upper stems, and shoot tips containing the shoot apical meristem (SAM) and flower buds. Also expressed in mature flowers, but weakly expressed in mature stems and leaves. {ECO:0000269|PubMed:12974814, ECO:0000269|PubMed:15960617}.
Functional Description ? help Back to Top
Source Description
TAIRGrowth regulating factor encoding transcription activator. One of the nine members of a GRF gene family, containing nuclear targeting domain. Involved in leaf development and expressed in root, shoot and flower.
UniProtTranscription activator that plays a role in the regulation of cell expansion in leaf and cotyledons tissues. Acts together with GIF1 for the development of appropriate leaf size and shape through the promotion and/or maintenance of cell proliferation activity in leaf primordia. {ECO:0000269|PubMed:15326298, ECO:0000269|PubMed:15960617}.
Function -- GeneRIF ? help Back to Top
  1. AN3 and AtGRF5 act together and are required for the development of appropriate leaf size and shape through the promotion and/or maintenance of cell proliferation.
    [PMID: 15960617]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G13960.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
IntActSearch Q8L8A6
Phenotype -- Disruption Phenotype ? help Back to Top
Source Description
UniProtDISRUPTION PHENOTYPE: Small and narrow leaves. {ECO:0000269|PubMed:15960617}.
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G13960
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY1026380.0AY102638.1 Arabidopsis thaliana transcription activator (GRF5) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_188012.20.0growth-regulating factor 5
SwissprotQ8L8A60.0GRF5_ARATH; Growth-regulating factor 5
TrEMBLR0I2Z10.0R0I2Z1_9BRAS; Uncharacterized protein
STRINGAT3G13960.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP4601684
MalvidsOGEM45672651
Publications ? help Back to Top
  1. Kim JH,Choi D,Kende H
    The AtGRF family of putative transcription factors is involved in leaf and cotyledon growth in Arabidopsis.
    Plant J., 2003. 36(1): p. 94-104
    [PMID:12974814]
  2. Kim JH,Kende H
    A transcriptional coactivator, AtGIF1, is involved in regulating leaf growth and morphology in Arabidopsis.
    Proc. Natl. Acad. Sci. U.S.A., 2004. 101(36): p. 13374-9
    [PMID:15326298]
  3. Horiguchi G,Kim GT,Tsukaya H
    The transcription factor AtGRF5 and the transcription coactivator AN3 regulate cell proliferation in leaf primordia of Arabidopsis thaliana.
    Plant J., 2005. 43(1): p. 68-78
    [PMID:15960617]
  4. Rodriguez RE, et al.
    Control of cell proliferation in Arabidopsis thaliana by microRNA miR396.
    Development, 2010. 137(1): p. 103-12
    [PMID:20023165]
  5. Ichihashi Y,Horiguchi G,Gleissberg S,Tsukaya H
    The bHLH transcription factor SPATULA controls final leaf size in Arabidopsis thaliana.
    Plant Cell Physiol., 2010. 51(2): p. 252-61
    [PMID:20040585]
  6. Gonzalez N, et al.
    Increased leaf size: different means to an end.
    Plant Physiol., 2010. 153(3): p. 1261-79
    [PMID:20460583]
  7. Vercruyssen L,Gonzalez N,Werner T,Schm
    Combining enhanced root and shoot growth reveals cross talk between pathways that control plant organ size in Arabidopsis.
    Plant Physiol., 2011. 155(3): p. 1339-52
    [PMID:21205622]
  8. Liang G,He H,Li Y,Wang F,Yu D
    Molecular mechanism of microRNA396 mediating pistil development in Arabidopsis.
    Plant Physiol., 2014. 164(1): p. 249-58
    [PMID:24285851]
  9. Debernardi JM, et al.
    Post-transcriptional control of GRF transcription factors by microRNA miR396 and GIF co-activator affects leaf size and longevity.
    Plant J., 2014. 79(3): p. 413-26
    [PMID:24888433]