PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G13890.1
Common NameATMYB26, MDC16.1, MS35, MYB26
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 367aa    MW: 41576.5 Da    PI: 7.7821
Description myb domain protein 26
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G13890.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.91.7e-161470148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT.........TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg.........kgRtlkqcksrwqkyl 48
                     rg W++eEde+l+++++ +G g+W++++++ g         + R++k+c++rw +yl
      AT3G13890.1 14 RGLWSPEEDEKLINYINSYGHGCWSSVPKHAGtythihgfcLQRCGKSCRLRWINYL 70
                     788****************************************************97 PP

2Myb_DNA-binding48.42.2e-1576118145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      rg+++++E  l+++++  lG++ W+ Ia++++ gRt++++k++w+
      AT3G13890.1  76 RGSFSPQEAALIIELHSILGNR-WAQIAKHLP-GRTDNEVKNFWN 118
                      899*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.8E-26673IPR009057Homeodomain-like
PROSITE profilePS5129416.313970IPR017930Myb domain
SuperFamilySSF466897.19E-2811117IPR009057Homeodomain-like
SMARTSM007173.7E-131372IPR001005SANT/Myb domain
PfamPF002492.7E-151470IPR001005SANT/Myb domain
CDDcd001672.31E-121770No hitNo description
PROSITE profilePS5129425.20971125IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.7E-2574125IPR009057Homeodomain-like
SMARTSM007171.5E-1575123IPR001005SANT/Myb domain
PfamPF002493.4E-1476119IPR001005SANT/Myb domain
CDDcd001672.91E-1178118No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0009739Biological Processresponse to gibberellin
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0009901Biological Processanther dehiscence
GO:0030154Biological Processcell differentiation
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000056anatomyflower bud
PO:0009056anatomyflower nectary
PO:0009066anatomyanther
PO:0009067anatomyfilament
PO:0009071anatomyanther wall tapetum
PO:0009074anatomystyle
PO:0020002anatomyanther wall endothecium
PO:0001170developmental stageseed development stage
Sequence ? help Back to Top
Protein Sequence    Length: 367 aa     Download sequence    Send to blast
MGHHSCCNKQ KVKRGLWSPE EDEKLINYIN SYGHGCWSSV PKHAGTYTHI HGFCLQRCGK  60
SCRLRWINYL RPDLKRGSFS PQEAALIIEL HSILGNRWAQ IAKHLPGRTD NEVKNFWNSS  120
IKKKLMSHHH HGHHHHHLSS MASLLTNLPY HNGFNPTTVD DESSRFMSNI ITNTNPNFIT  180
PSHLSLPSPH VMTPLMFPTS REGDFKFLTT NNPNQSHHHD NNHYNNLDIL SPTPTINNHH  240
QPSLSSCPHD NNLQWPALPD FPASTISGFQ ETLQDYDDAN KLNVFVTPFN DNAKKLLCGE  300
VLEGKVLSSS SPISQDHGLF LPTTYNFQMT STSDHQHHHR VDSYINHMII PSSSSSSPIS  360
CGQYVIT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-30141257108B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.56330.0flower
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO58233260.0
Genevisible258195_at0.0
Expression AtlasAT3G13890-
AtGenExpressAT3G13890-
ATTED-IIAT3G13890-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed in anthers early during endothecial development, with maximal expression during pollen mitosis I and bicellular stages. {ECO:0000269|PubMed:17329564}.
UniprotTISSUE SPECIFICITY: Highly expressed in flowers. {ECO:0000269|PubMed:12753590}.
Functional Description ? help Back to Top
Source Description
TAIREncodes a putative transcription factor (MYB26). Mutants produces fertile pollen but plants are sterile because anthers do not dehisce. The cellulosic secondary wall thickenings are not formed in the endothecium as they are in non-mutant plants.
UniProtProbable transcription factor that regulates lignified secondary cell wall thickening of the anther endocethium, which is necessary for anther dehiscence (PubMed:12753590, PubMed:17147638, PubMed:17329564). May play a role in specifying early endothecial cell development by regulating a number of genes linked to secondary thickening such as NST1 and NST2. Acts upstream of the lignin biosynthesis pathway (PubMed:17329564). {ECO:0000269|PubMed:12753590, ECO:0000269|PubMed:17147638, ECO:0000269|PubMed:17329564}.
Function -- GeneRIF ? help Back to Top
  1. Data suggest that MYB26 functions in a regulatory role involved in determining endothecial cell development within the anther and acts upstream of the lignin biosynthesis pathway.
    [PMID: 17329564]
  2. The MYB26 protein is localized specifically to the anther endothecium nuclei and that it directly regulates two NAC domain genes, NST1 and NST2, which are critical for the induction of secondary thickening biosynthesis genes.
    [PMID: 28724622]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G13890.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Down-regulated by auxin. {ECO:0000269|PubMed:23410518}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT2G38080(A), AT2G46770(A), AT3G61910(A), AT4G18780(A), AT5G17420(A), AT5G54690(A)
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDgibberellin
Phenotype -- Disruption Phenotype ? help Back to Top
Source Description
UniProtDISRUPTION PHENOTYPE: Male sterility due to a defect in anther dehiscence. Fertile pollen. {ECO:0000269|PubMed:12753590}.
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G13890
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF1759970.0AF175997.1 Arabidopsis thaliana putative transcription factor (MYB26) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_566467.20.0myb domain protein 26
SwissprotQ9SPG30.0MYB26_ARATH; Transcription factor MYB26
TrEMBLA0A178VHB10.0A0A178VHB1_ARATH; MYB26
STRINGAT3G13890.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM128031930
Representative plantOGRP5171784
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  3. Steiner-Lange S, et al.
    Disruption of Arabidopsis thaliana MYB26 results in male sterility due to non-dehiscent anthers.
    Plant J., 2003. 34(4): p. 519-28
    [PMID:12753590]
  4. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  5. Underwood BA,Vanderhaeghen R,Whitford R,Town CD,Hilson P
    Simultaneous high-throughput recombinational cloning of open reading frames in closed and open configurations.
    Plant Biotechnol. J., 2006. 4(3): p. 317-24
    [PMID:17147637]
  6. Mitsuda N, et al.
    Efficient production of male and female sterile plants by expression of a chimeric repressor in Arabidopsis and rice.
    Plant Biotechnol. J., 2006. 4(3): p. 325-32
    [PMID:17147638]
  7. Yang C, et al.
    Arabidopsis MYB26/MALE STERILE35 regulates secondary thickening in the endothecium and is essential for anther dehiscence.
    Plant Cell, 2007. 19(2): p. 534-48
    [PMID:17329564]
  8. Zhong R,Richardson EA,Ye ZH
    The MYB46 transcription factor is a direct target of SND1 and regulates secondary wall biosynthesis in Arabidopsis.
    Plant Cell, 2007. 19(9): p. 2776-92
    [PMID:17890373]
  9. Rengel D, et al.
    A new genomic resource dedicated to wood formation in Eucalyptus.
    BMC Plant Biol., 2009. 9: p. 36
    [PMID:19327132]
  10. Nelson MR, et al.
    A biomechanical model of anther opening reveals the roles of dehydration and secondary thickening.
    New Phytol., 2012. 196(4): p. 1030-7
    [PMID:22998410]
  11. Cecchetti V, et al.
    Auxin controls Arabidopsis anther dehiscence by regulating endothecium lignification and jasmonic acid biosynthesis.
    Plant J., 2013. 74(3): p. 411-22
    [PMID:23410518]
  12. Efroni I, et al.
    Regulation of leaf maturation by chromatin-mediated modulation of cytokinin responses.
    Dev. Cell, 2013. 24(4): p. 438-45
    [PMID:23449474]
  13. Coego A, et al.
    The TRANSPLANTA collection of Arabidopsis lines: a resource for functional analysis of transcription factors based on their conditional overexpression.
    Plant J., 2014. 77(6): p. 944-53
    [PMID:24456507]
  14. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]
  15. Yang C, et al.
    Transcription Factor MYB26 Is Key to Spatial Specificity in Anther Secondary Thickening Formation.
    Plant Physiol., 2017. 175(1): p. 333-350
    [PMID:28724622]
  16. Ghelli R, et al.
    A Newly Identified Flower-Specific Splice Variant of AUXIN RESPONSE FACTOR8 Regulates Stamen Elongation and Endothecium Lignification in Arabidopsis.
    Plant Cell, 2018. 30(3): p. 620-637
    [PMID:29514943]