PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G13850.1
Common NameASL30, LBD22, MCP4.8
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family LBD
Protein Properties Length: 268aa    MW: 30567.2 Da    PI: 6.3101
Description LOB domain-containing protein 22
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G13850.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260128.92.3e-40361351100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  aCaaCk++rrkCa+dC lapyfp++++++f n+hklFG+sn++k++k+l + e+++am++++++++ara+dPv G++g+i+klq q+e +++el+ + 
  AT3G13850.1  36 ACAACKYQRRKCAPDCLLAPYFPHDRHRQFLNAHKLFGVSNITKIIKSLTPPEKDAAMHTIMFQSDARANDPVDGCYGIIKKLQYQIEYTRNELEIVL 133
                  7*********************************************************************************************9987 PP

       DUF260  99 ee 100
                  ++
  AT3G13850.1 134 QQ 135
                  76 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.40735136IPR004883Lateral organ boundaries, LOB
PfamPF031953.2E-3736132IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008150Biological Processbiological_process
Sequence ? help Back to Top
Protein Sequence    Length: 268 aa     Download sequence    Send to blast
MPSGKPSSVF PLHPKPTPLK PSSSTSSSNN NSTNQACAAC KYQRRKCAPD CLLAPYFPHD  60
RHRQFLNAHK LFGVSNITKI IKSLTPPEKD AAMHTIMFQS DARANDPVDG CYGIIKKLQY  120
QIEYTRNELE IVLQQLAMFR DRAHQHHHQE PHIQMQEQED LSSFSSSCDL NNNNSIPYNY  180
PLNHIQEPNQ QQYCSSGNNF SGLQEDMWCL QLQDSSTIVN MKAGFIDECE DVKPVEEVSS  240
ERHEFEPHEA FVEQRKLDLP SAQYIISS
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO2402553400.0
Expression AtlasAT3G13850-
AtGenExpressAT3G13850-
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G13850.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G13850
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0026860.0CP002686.1 Arabidopsis thaliana chromosome 3, complete sequence.
GenBankAB4738630.0AB473863.1 Arabidopsis thaliana ASL30 mRNA for ASYMMETRIC LEAVES2-like 30 protein, complete cds.
GenBankAB0286100.0AB028610.1 Arabidopsis thaliana genomic DNA, chromosome 3, P1 clone: MCP4.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_188001.10.0LOB domain-containing protein 22
SwissprotQ9LRW10.0LBD22_ARATH; LOB domain-containing protein 22
TrEMBLD7L2921e-178D7L292_ARALL; LOB domain family protein
TrEMBLR0HMS11e-178R0HMS1_9BRAS; Uncharacterized protein
STRINGAT3G13850.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP55241021
MalvidsOGEM64982645
Publications ? help Back to Top
  1. Iwakawa H, et al.
    The ASYMMETRIC LEAVES2 gene of Arabidopsis thaliana, required for formation of a symmetric flat leaf lamina, encodes a member of a novel family of proteins characterized by cysteine repeats and a leucine zipper.
    Plant Cell Physiol., 2002. 43(5): p. 467-78
    [PMID:12040093]
  2. Shuai B,Reynaga-Peña CG,Springer PS
    The lateral organ boundaries gene defines a novel, plant-specific gene family.
    Plant Physiol., 2002. 129(2): p. 747-61
    [PMID:12068116]
  3. Dal Bosco C, et al.
    Inactivation of the chloroplast ATP synthase gamma subunit results in high non-photochemical fluorescence quenching and altered nuclear gene expression in Arabidopsis thaliana.
    J. Biol. Chem., 2004. 279(2): p. 1060-9
    [PMID:14576160]
  4. Wagner R,Pfannschmidt T
    Eukaryotic transcription factors in plastids--Bioinformatic assessment and implications for the evolution of gene expression machineries in plants.
    Gene, 2006. 381: p. 62-70
    [PMID:16934950]
  5. Matsumura Y,Iwakawa H,Machida Y,Machida C
    Characterization of genes in the ASYMMETRIC LEAVES2/LATERAL ORGAN BOUNDARIES (AS2/LOB) family in Arabidopsis thaliana, and functional and molecular comparisons between AS2 and other family members.
    Plant J., 2009. 58(3): p. 525-37
    [PMID:19154202]
  6. Efroni I, et al.
    Regulation of leaf maturation by chromatin-mediated modulation of cytokinin responses.
    Dev. Cell, 2013. 24(4): p. 438-45
    [PMID:23449474]