PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G13040.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family G2-like
Protein Properties Length: 449aa    MW: 50112.1 Da    PI: 6.6479
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G13040.2genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like99.71.9e-31241295155
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                  k r+rWtpeLHe+Fv+av +L G+ekAtPk++++lm+v+gLt++hvkSHLQkYRl
  AT3G13040.2 241 KSRMRWTPELHESFVKAVIKLEGPEKATPKAVKKLMNVEGLTIYHVKSHLQKYRL 295
                  68****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.921238298IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.4E-29239296IPR009057Homeodomain-like
SuperFamilySSF466893.23E-16240295IPR009057Homeodomain-like
TIGRFAMsTIGR015571.0E-23241296IPR006447Myb domain, plants
PfamPF002495.8E-9243294IPR001005SANT/Myb domain
PfamPF143793.5E-22331378IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 449 aa     Download sequence    Send to blast
MYIKAIMNRH RLLSAATDEC NKKLGQACSS SLSPVHNFLN VQPEHRKTPF IRSQSPDSPG  60
QLWPKNSSQS TFSRSSTFCT NLYLSSSSTS ETQKHLGNSL PFLPDPSSYT HSASGVESAR  120
SPSIFTEDLG NQCDGGNSGS LLKDFLNLSG DACSDGDFHD FGCSNDSYCL SDQMELQFLS  180
DELELAITDR AETPRLDEIY ETPLASNPVT RLSPSQSCVP GAMSVDVVSS HPSPGSAANQ  240
KSRMRWTPEL HESFVKAVIK LEGPEKATPK AVKKLMNVEG LTIYHVKSHL QKYRLAKYMP  300
EKKEEKRTDN SEEKKLALSK SEADEKKKGA IQLTEALRMQ MEVQKQLHEQ LEVQRVLQLR  360
IEEHAKYLEK MLEEQRKTGR WISSSSQTVL SPSDDSIPDS QNMSKTKASS PQPPLPAENK  420
ASETEDDKCE SPQKRRRLEN IAESEDPKR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-23241298259Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-23241298259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-23241298259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-23241298259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-23241298259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-23241298259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-23241298259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-23241298259Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1433437KRRRL
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.119930.0bud| flower| root| silique
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO306824250.0
Genevisible257855_at0.0
Expression AtlasAT3G13040-
AtGenExpressAT3G13040-
ATTED-IIAT3G13040-
Function -- GeneRIF ? help Back to Top
  1. At3g13040 directly interacted with At2g20400 (gammaMYB1) and enhanced its activation.
    [PMID: 26872838]
  2. Results demonstrate that gammaMYB2 acts as a repressor that modulates secondary cell wall thickening in the primary stem and anther in Arabidopsis. [gammaMYB2]
    [PMID: 30930225]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00354DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G13040.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
BioGRIDAT1G14920
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G13040
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0508890.0AY050889.1 Arabidopsis thaliana unknown protein (At3g13040) mRNA, complete cds.
GenBankAY0966740.0AY096674.1 Arabidopsis thaliana unknown protein (At3g13040) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001319536.10.0myb-like HTH transcriptional regulator family protein
RefseqNP_566442.10.0myb-like HTH transcriptional regulator family protein
RefseqNP_974298.10.0myb-like HTH transcriptional regulator family protein
SwissprotQ949U20.0PHL6_ARATH; Myb family transcription factor PHL6
TrEMBLA0A178VHF60.0A0A178VHF6_ARATH; Uncharacterized protein
STRINGAT3G13040.10.0(Arabidopsis thaliana)
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Efroni I, et al.
    Regulation of leaf maturation by chromatin-mediated modulation of cytokinin responses.
    Dev. Cell, 2013. 24(4): p. 438-45
    [PMID:23449474]
  3. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  4. Mar
    Large-scale identification of gibberellin-related transcription factors defines group VII ETHYLENE RESPONSE FACTORS as functional DELLA partners.
    Plant Physiol., 2014. 166(2): p. 1022-32
    [PMID:25118255]
  5. Nguyen HT, et al.
    A Transcription Factor γMYB1 Binds to the P1BS cis-Element and Activates PLA2-γ Expression with its Co-Activator γMYB2.
    Plant Cell Physiol., 2016. 57(4): p. 784-97
    [PMID:26872838]
  6. Nguyen HTK,Hyoung S,Kim HJ,Cho KM,Shin JS
    The transcription factor γMYB2 acts as a negative regulator of secondary cell wall thickening in anther and stem.
    Gene, 2019. 702: p. 158-165
    [PMID:30930225]