PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G12910.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 303aa    MW: 35198.4 Da    PI: 8.8534
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G12910.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM156.89.2e-49221502128
          NAM   2 ppGfrFhPtdeelvveyLkkkvegkk.leleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk..k 96 
                   pGfrFhPtdeelv +yL kkv  kk  +++e+++++diyk++PwdLp + +++eke yfF+kr +ky+++ r+nr+t sg+Wkatg dk+v+s   +
  AT3G12910.1  22 LPGFRFHPTDEELVGYYLSKKVLLKKtSKIDEIVSQIDIYKFDPWDLP-RSRNTEKESYFFCKRGRKYRNSIRPNRVTGSGFWKATGIDKPVYSDgsN 118
                  59*******************8877747777889**************.5567789**************************************9767 PP

          NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                  ++++glkktLv+y g+a kg+ktdW+mhe+rl
  AT3G12910.1 119 KAVIGLKKTLVYYLGSAGKGNKTDWMMHEFRL 150
                  777***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100550.72621185IPR003441NAC domain
SuperFamilySSF1019412.62E-4922184IPR003441NAC domain
PfamPF023657.2E-2523150IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000293anatomyguard cell
PO:0009029anatomystamen
PO:0009047anatomystem
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 303 aa     Download sequence    Send to blast
MEKMIEPRDN TRESEDEDAL KLPGFRFHPT DEELVGYYLS KKVLLKKTSK IDEIVSQIDI  60
YKFDPWDLPR SRNTEKESYF FCKRGRKYRN SIRPNRVTGS GFWKATGIDK PVYSDGSNKA  120
VIGLKKTLVY YLGSAGKGNK TDWMMHEFRL PTANDTIPGG PTHSNPTPTS LLHAEVWTLC  180
RIFKRTVSSR KYTPDWRELA NGKRVKQQQS NYQEAYINFG DNESSSSTNV MNVREGKGNY  240
ERSVFQLQQT PYQHQNQPIL MDTTHVDSFQ HFSNDNIHHE TYETWPDELR SVVEFAFPPS  300
FLS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A7e-44121855168Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.395250.0root
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1453384330.0
Genevisible257846_at0.0
Expression AtlasAT3G12910-
AtGenExpressAT3G12910-
ATTED-IIAT3G12910-
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00353DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G12910.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Interaction ? help Back to Top
Source Intact With
BioGRIDAT1G14920
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G12910
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0026860.0CP002686.1 Arabidopsis thaliana chromosome 3, complete sequence.
GenBankAB0266450.0AB026645.1 Arabidopsis thaliana genomic DNA, chromosome 3, P1 clone: MGH6.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_187897.20.0no apical meristem domain-containing transcriptional regulator
SwissprotQ9SK554e-75NAC42_ARATH; Transcription factor JUNGBRUNNEN 1
TrEMBLQ9LSI40.0Q9LSI4_ARATH; No apical meristem domain-containing transcriptional regulator
STRINGAT3G12910.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1715800
MalvidsOGEM30628200
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Mar
    Large-scale identification of gibberellin-related transcription factors defines group VII ETHYLENE RESPONSE FACTORS as functional DELLA partners.
    Plant Physiol., 2014. 166(2): p. 1022-32
    [PMID:25118255]