PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G12480.1
Common NameNF-YC11
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NF-YC
Protein Properties Length: 293aa    MW: 32291.7 Da    PI: 4.8618
Description nuclear factor Y, subunit C11
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G12480.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC58.41.6e-186861898
        NF-YC 18 nhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivpr 98
                 ++++P arikki++adedv +i+  +Pvl+sk+ elf+ +l  r++  + e   +t+    ++ +v+r ++fdfl ++v +
  AT3G12480.1  6 DTRFPAARIKKIMQADEDVGKIALAVPVLVSKSLELFLQDLCDRTYEITLERGAKTVSSLHLKHCVERYNVFDFLREVVSK 86
                 5789************************************************************************99976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.102.7E-25372IPR009072Histone-fold
SuperFamilySSF471132.37E-19488IPR009072Histone-fold
PfamPF008082.7E-19871IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000005anatomycultured plant cell
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000084anatomyplant sperm cell
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025195anatomypollen tube cell
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 293 aa     Download sequence    Send to blast
MRKKLDTRFP AARIKKIMQA DEDVGKIALA VPVLVSKSLE LFLQDLCDRT YEITLERGAK  60
TVSSLHLKHC VERYNVFDFL REVVSKVPDY GHSQGQGHGD VTMDDRSISK RRKPISDEVN  120
DSDEEYKKSK TQEIGSAKTS GRGGRGRGRG RGRGGRAAKA AEREGLNREM EVEAANSGQP  180
PPEDNVKMHA SESSPQEDEK KGIDGTAASN EDTKQHLQSP KEGIDFDLNA ESLDLNETKL  240
APATGTTTTT TAATDSEEYS GWPMMDISKM DPAQLASLGK RIDEDEEDYD EEG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1jfi_A7e-23272575Transcription Regulator NC2 alpha chain
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1144153RGRGRGRGRG
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.486500.0flower| root| silique
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1453384170.0
Genevisible256258_at0.0
Expression AtlasAT3G12480-
AtGenExpressAT3G12480-
ATTED-IIAT3G12480-
Function -- GeneRIF ? help Back to Top
  1. A mutant deficient in NF-YC11/NC2alpha exhibited similar phenotypes to grxs17 in response to photoperiod. Therefore, we propose that GRXS17 interacts with NF-YC11/NC2alpha to relay a redox signal generated by the photoperiod to maintain meristem function.
    [PMID: 25699589]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G12480.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
BioGRIDAT4G14540, AT5G08190, AT5G47640, AT1G21970
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G12480
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF4628410.0AF462841.1 Arabidopsis thaliana At3g12480/MQC3.32 mRNA, complete cds.
GenBankAY1438470.0AY143847.1 Arabidopsis thaliana At3g12480/MQC3.32 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_187854.20.0nuclear factor Y, subunit C11
TrEMBLA0A384KK080.0A0A384KK08_ARATH; NF-YC11
TrEMBLQ9LHG00.0Q9LHG0_ARATH; At3g12480/MQC3.32
STRINGAT3G12480.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM35062458
Representative plantOGRP21791635
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Ascencio-Ib
    Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection.
    Plant Physiol., 2008. 148(1): p. 436-54
    [PMID:18650403]
  3. Wang Y, et al.
    Transcriptome analyses show changes in gene expression to accompany pollen germination and tube growth in Arabidopsis.
    Plant Physiol., 2008. 148(3): p. 1201-11
    [PMID:18775970]
  4. Reiland S, et al.
    Large-scale Arabidopsis phosphoproteome profiling reveals novel chloroplast kinase substrates and phosphorylation networks.
    Plant Physiol., 2009. 150(2): p. 889-903
    [PMID:19376835]
  5. Ito J, et al.
    Analysis of the Arabidopsis cytosolic proteome highlights subcellular partitioning of central plant metabolism.
    J. Proteome Res., 2011. 10(4): p. 1571-82
    [PMID:21166475]
  6. Arabidopsis Interactome Mapping Consortium
    Evidence for network evolution in an Arabidopsis interactome map.
    Science, 2011. 333(6042): p. 601-7
    [PMID:21798944]
  7. Hackenberg D, et al.
    Studies on differential nuclear translocation mechanism and assembly of the three subunits of the Arabidopsis thaliana transcription factor NF-Y.
    Mol Plant, 2012. 5(4): p. 876-88
    [PMID:22199235]
  8. Knuesting J, et al.
    Arabidopsis glutaredoxin S17 and its partner, the nuclear factor Y subunit C11/negative cofactor 2α, contribute to maintenance of the shoot apical meristem under long-day photoperiod.
    Plant Physiol., 2015. 167(4): p. 1643-58
    [PMID:25699589]