PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G11440.1
Common NameATMYB65, F24K9.11, MYB65
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 553aa    MW: 61365.4 Da    PI: 6.5066
Description myb domain protein 65
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G11440.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.97.2e-164390148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT  Ed +l+d+vk++G g+W+++ ++  + R++k+c++rw ++l
      AT3G11440.1 43 KGPWTSTEDGILIDYVKKHGEGNWNAVQKHTSLARCGKSCRLRWANHL 90
                     79******************************************9986 PP

2Myb_DNA-binding51.22.9e-1696139146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++++eE++l+v+ ++++G++ W+  a++++ gRt++++k++w++
      AT3G11440.1  96 KGAFSQEEEQLIVEMHAKMGNK-WAQMAEHLP-GRTDNEIKNYWNT 139
                      799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF00169301553IPR016310Transcription factor, GAMYB
PROSITE profilePS5129415.8543890IPR017930Myb domain
SuperFamilySSF466893.59E-2942137IPR009057Homeodomain-like
SMARTSM007171.4E-114292IPR001005SANT/Myb domain
PfamPF002495.5E-144390IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.1E-234497IPR009057Homeodomain-like
CDDcd001677.63E-104590No hitNo description
PROSITE profilePS5129425.7891145IPR017930Myb domain
SMARTSM007177.3E-1795143IPR001005SANT/Myb domain
PfamPF002494.9E-1596139IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.0E-2598144IPR009057Homeodomain-like
CDDcd001673.76E-1298139No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0009723Biological Processresponse to ethylene
GO:0009740Biological Processgibberellic acid mediated signaling pathway
GO:0009751Biological Processresponse to salicylic acid
GO:0009908Biological Processflower development
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0045926Biological Processnegative regulation of growth
GO:0048235Biological Processpollen sperm cell differentiation
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000191anatomysynergid
PO:0000229anatomyflower meristem
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 553 aa     Download sequence    Send to blast
MSYTTATADS DDGMHSSIHN ESPAPDSISN GCRSRGKRSV LKKGPWTSTE DGILIDYVKK  60
HGEGNWNAVQ KHTSLARCGK SCRLRWANHL RPNLKKGAFS QEEEQLIVEM HAKMGNKWAQ  120
MAEHLPGRTD NEIKNYWNTR IKRRQRAGLP LYPPEIYVDD LHWSEEYTKS NIIRVDRRRR  180
HQDFLQLGNS KDNVLFDDLN FAASLLPAAS DLSDLVACNM LGTGASSSRY ESYMPPILPS  240
PKQIWESGSR FPMCSSNIKH EFQSPEHFQN TAVQKNPRSC SISPCDVDHH PYENQHSSHM  300
MMVPDSHTVT YGMHPTSKPL FGAVKLELPS FQYSETSAFD QWKTTPSPPH SDLLDSVDAY  360
IQSPPPSQVE ESDCFSSCDT GLLDMLLHEA KIKTSAKHSL LMSSPQKSFS STTCTTNVTQ  420
NVPRGSENLI KSGEYEDSQK YLGRSEITSP SQLSAGGFSS AFAGNVVKTE ELDQVWEPKR  480
VDITRPDVLL ASSWLDQGCY GIVSDTSSMS DALALLGGDD IGNSYVTVGS SSGQAPRGVG  540
SYGWTNMPPV WSL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-32411445107B-MYB
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1453383730.0
Genevisible259283_at0.0
Expression AtlasAT3G11440-
AtGenExpressAT3G11440-
ATTED-IIAT3G11440-
Functional Description ? help Back to Top
Source Description
TAIRMember of the R2R3-MYB gene family. Similar to GA-induced Barley myb gene. May be induced during germination in response to GA. Double mutants with MYB33 are male sterile, showing defects in pollen development and anther development. Contains a binding site for miRNA159 and may be spatially regulated by this micro RNA. The male sterile phenotype of the MYB33/MYB65 double mutant is light and temperature sensitive. Fertility can be restored with increased light intensity and lower temperatures.
UniProtTranscriptional activator of gibberellin-dependent alpha-amylase expression in aleurone cells. Involved in pollen and floral organs development. {ECO:0000256|PIRNR:PIRNR001693}.
Function -- GeneRIF ? help Back to Top
  1. Consistent with functional redundancy, promoter-GUS fusions of MYB33 and MYB65 gave identical expression patterns in flowers (sepals, style, receptacle, anther filaments, and connective but not in anthers themselves), shoot apices, and root tips.
    [PMID: 15722475]
  2. MYB33 and MYB65 play no part in gibberellin-mediated growth or flowering in vegetative tissues.
    [PMID: 20699403]
  3. There may be factors, in addition to complementarity, that control plant miRNA efficacy, such factors appear to be optimised in regards to the endogenous and ancient miR159:MYB33/65 relationship.
    [PMID: 24103298]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00348DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G11440.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT2G16910(A)
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDethylene, gibberellin, salicylic acid
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G11440
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0051200.0BT005120.1 Arabidopsis thaliana clone U20731 putative Myb DNA-binding protein (At3g11440) mRNA, complete cds.
GenBankBT0039400.0BT003940.1 Arabidopsis thaliana clone RAFL15-06-P04 (R20731) putative Myb DNA-binding protein (At3g11440) mRNA, complete cds.
GenBankAY5195850.0AY519585.1 Arabidopsis thaliana MYB transcription factor (At3g11440) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_187751.10.0myb domain protein 65
TrEMBLQ9FR970.0Q9FR97_ARATH; Transcription factor
STRINGAT3G11440.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
MalvidsOGEM38022859
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  3. Gocal GF, et al.
    GAMYB-like genes, flowering, and gibberellin signaling in Arabidopsis.
    Plant Physiol., 2001. 127(4): p. 1682-93
    [PMID:11743113]
  4. Vazquez F,Gasciolli V,Cr
    The nuclear dsRNA binding protein HYL1 is required for microRNA accumulation and plant development, but not posttranscriptional transgene silencing.
    Curr. Biol., 2004. 14(4): p. 346-51
    [PMID:14972688]
  5. Vaucheret H,Vazquez F,Cr
    The action of ARGONAUTE1 in the miRNA pathway and its regulation by the miRNA pathway are crucial for plant development.
    Genes Dev., 2004. 18(10): p. 1187-97
    [PMID:15131082]
  6. Achard P,Herr A,Baulcombe DC,Harberd NP
    Modulation of floral development by a gibberellin-regulated microRNA.
    Development, 2004. 131(14): p. 3357-65
    [PMID:15226253]
  7. Yoo BC, et al.
    A systemic small RNA signaling system in plants.
    Plant Cell, 2004. 16(8): p. 1979-2000
    [PMID:15258266]
  8. Souret FF,Kastenmayer JP,Green PJ
    AtXRN4 degrades mRNA in Arabidopsis and its substrates include selected miRNA targets.
    Mol. Cell, 2004. 15(2): p. 173-83
    [PMID:15260969]
  9. Bravo J,Aguilar-Henonin L,Olmedo G,Guzm
    Four distinct classes of proteins as interaction partners of the PABC domain of Arabidopsis thaliana Poly(A)-binding proteins.
    Mol. Genet. Genomics, 2005. 272(6): p. 651-65
    [PMID:15650869]
  10. Millar AA,Gubler F
    The Arabidopsis GAMYB-like genes, MYB33 and MYB65, are microRNA-regulated genes that redundantly facilitate anther development.
    Plant Cell, 2005. 17(3): p. 705-21
    [PMID:15722475]
  11. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  12. Zhang W, et al.
    Regulation of Arabidopsis tapetum development and function by DYSFUNCTIONAL TAPETUM1 (DYT1) encoding a putative bHLH transcription factor.
    Development, 2006. 133(16): p. 3085-95
    [PMID:16831835]
  13. Wijeratne AJ, et al.
    Differential gene expression in Arabidopsis wild-type and mutant anthers: insights into anther cell differentiation and regulatory networks.
    Plant J., 2007. 52(1): p. 14-29
    [PMID:17666023]
  14. Xing S,Zachgo S
    ROXY1 and ROXY2, two Arabidopsis glutaredoxin genes, are required for anther development.
    Plant J., 2008. 53(5): p. 790-801
    [PMID:18036205]
  15. Wuest SE, et al.
    Arabidopsis female gametophyte gene expression map reveals similarities between plant and animal gametes.
    Curr. Biol., 2010. 20(6): p. 506-12
    [PMID:20226671]
  16. Alonso-Peral MM, et al.
    The microRNA159-regulated GAMYB-like genes inhibit growth and promote programmed cell death in Arabidopsis.
    Plant Physiol., 2010. 154(2): p. 757-71
    [PMID:20699403]
  17. Allen RS, et al.
    MicroR159 regulation of most conserved targets in Arabidopsis has negligible phenotypic effects.
    Silence, 2010. 1(1): p. 18
    [PMID:21029441]
  18. Alonso-Peral MM,Sun C,Millar AA
    MicroRNA159 can act as a switch or tuning microRNA independently of its abundance in Arabidopsis.
    PLoS ONE, 2012. 7(4): p. e34751
    [PMID:22511963]
  19. Deveson I,Li J,Millar AA
    MicroRNAs with analogous target complementarities perform with highly variable efficacies in Arabidopsis.
    FEBS Lett., 2013. 587(22): p. 3703-8
    [PMID:24103298]
  20. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]