PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G11280.2
Common NameF11B9.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 263aa    MW: 29608.2 Da    PI: 6.7299
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G11280.2genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding23.21.6e-073177246
                     SSS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  2 grWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqk 46
                     g+WT+eE + + +a + +  +   +W ++a++++ g+t  ++   + k
      AT3G11280.2 31 GSWTKEENKMFERALAIYAEDspdRWFKVASMIP-GKTVFDVMKQYSK 77
                     89*****************99*************.***9999888876 PP

2Myb_DNA-binding39.99.8e-13128172347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ +++ +  ++G+g+W+ I+r +   +t+ q+ s+ qky
      AT3G11280.2 128 PWTEEEHRRFLLGLLKYGKGDWRNISRNFVVSKTPTQVASHAQKY 172
                      8*****************************99************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512938.3492881IPR017884SANT domain
SMARTSM007171.7E-82981IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-43077IPR009057Homeodomain-like
PfamPF002492.1E-63177IPR001005SANT/Myb domain
SuperFamilySSF466899.33E-123186IPR009057Homeodomain-like
CDDcd001673.12E-73378No hitNo description
PROSITE profilePS5129418.577121177IPR017930Myb domain
SuperFamilySSF466892.3E-15123176IPR009057Homeodomain-like
TIGRFAMsTIGR015571.5E-17124176IPR006447Myb domain, plants
SMARTSM007171.7E-10125175IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.3E-11125177IPR009057Homeodomain-like
CDDcd001674.90E-9128172No hitNo description
PfamPF002494.2E-10128172IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 263 aa     Download sequence    Send to blast
METLHPFSHL PISDHRFVVQ EMVSLHSSSS GSWTKEENKM FERALAIYAE DSPDRWFKVA  60
SMIPGKTVFD VMKQYSKLEE DVFDIEAGRV PIPGYPAASS PLGFDTDMCR KRPSGARGSD  120
QDRKKGVPWT EEEHRRFLLG LLKYGKGDWR NISRNFVVSK TPTQVASHAQ KYYQRQLSGA  180
KDKRRPSIHD ITTGNLLNAN LNRSFSDHRD ILPDLGFIDK DDTEEGVIFM GQNLSSENLF  240
SPSPTSFEAA INFAGENVFS AGA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A2e-1627110288RADIALIS
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.235480.0flower| leaf| root
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible256255_at0.0
Expression AtlasAT3G11280-
AtGenExpressAT3G11280-
ATTED-IIAT3G11280-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Detected in the apical inflorescence meristem, in bract primordia arising in its periphery and in floral meristems produced in the axils of bracts (stages 0-3). From stage 3 to stage 8, detected in all floral organs irrespective of their dorsoventral positions. From stage 9, barely detectable in bracts, sepals, and stamens. In the corolla, however, expression was maintained and enhanced in some regions. Within ventral and lateral petals at stage 9, asymmetric pattern of expression with high levels of transcripts in the inner epidermis of the furrow and very reduced levels in the remaining cell layers. In the dorsal petals, from stage 9 onward, detected but with a more even distribution across cell layers than in the ventral petal. {ECO:0000269|PubMed:11937495}.
Functional Description ? help Back to Top
Source Description
TAIRPutative transcription factors interacting with the gene product of VHA-B1 (vacuolar ATPase subunit B1; as shown through yeast two-hybrid assay).
UniProtInvolved in the dorsovental asymmetry of flowers. Promotes ventral identity. {ECO:0000269|PubMed:11937495, ECO:0000269|PubMed:9118809}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00347DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G11280.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDsalicylic acid
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G11280
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0561800.0AY056180.1 Arabidopsis thaliana putative MYB-family transcription factor (At3g11280) mRNA, complete cds.
GenBankAY0912650.0AY091265.1 Arabidopsis thaliana putative MYB-family transcription factor (At3g11280) mRNA, complete cds.
GenBankAY5503080.0AY550308.1 Arabidopsis thaliana MYB transcription factor (At3g11280) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_187737.10.0Duplicated homeodomain-like superfamily protein
RefseqNP_850558.10.0Duplicated homeodomain-like superfamily protein
SwissprotQ8S9H72e-71DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A384KX370.0A0A384KX37_ARATH; Uncharacterized protein
TrEMBLQ9C7730.0Q9C773_ARATH; Duplicated homeodomain-like superfamily protein
STRINGAT3G11280.20.0(Arabidopsis thaliana)
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Galego L,Almeida J
    Role of DIVARICATA in the control of dorsoventral asymmetry in Antirrhinum flowers.
    Genes Dev., 2002. 16(7): p. 880-91
    [PMID:11937495]
  3. Hoth S, et al.
    Monitoring genome-wide changes in gene expression in response to endogenous cytokinin reveals targets in Arabidopsis thaliana.
    FEBS Lett., 2003. 554(3): p. 373-80
    [PMID:14623097]
  4. Contento AL,Kim SJ,Bassham DC
    Transcriptome profiling of the response of Arabidopsis suspension culture cells to Suc starvation.
    Plant Physiol., 2004. 135(4): p. 2330-47
    [PMID:15310832]
  5. Blanco F, et al.
    Identification of NPR1-dependent and independent genes early induced by salicylic acid treatment in Arabidopsis.
    Plant Mol. Biol., 2005. 59(6): p. 927-44
    [PMID:16307367]
  6. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  7. Cao D,Cheng H,Wu W,Soo HM,Peng J
    Gibberellin mobilizes distinct DELLA-dependent transcriptomes to regulate seed germination and floral development in Arabidopsis.
    Plant Physiol., 2006. 142(2): p. 509-25
    [PMID:16920880]
  8. Cho YH,Yoo SD,Sheen J
    Regulatory functions of nuclear hexokinase1 complex in glucose signaling.
    Cell, 2006. 127(3): p. 579-89
    [PMID:17081979]
  9. Zentella R, et al.
    Global analysis of della direct targets in early gibberellin signaling in Arabidopsis.
    Plant Cell, 2007. 19(10): p. 3037-57
    [PMID:17933900]
  10. Brady SM, et al.
    A stele-enriched gene regulatory network in the Arabidopsis root.
    Mol. Syst. Biol., 2011. 7: p. 459
    [PMID:21245844]
  11. Josse EM, et al.
    A DELLA in disguise: SPATULA restrains the growth of the developing Arabidopsis seedling.
    Plant Cell, 2011. 23(4): p. 1337-51
    [PMID:21478445]
  12. Machemer K, et al.
    Interplay of MYB factors in differential cell expansion, and consequences for tomato fruit development.
    Plant J., 2011. 68(2): p. 337-50
    [PMID:21707804]
  13. Almeida J,Rocheta M,Galego L
    Genetic control of flower shape in Antirrhinum majus.
    Development, 1997. 124(7): p. 1387-92
    [PMID:9118809]