PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G11090.1
Common NameASL12, F11B9.5, F9F8.10, LBD21
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family LBD
Protein Properties Length: 165aa    MW: 18159.8 Da    PI: 6.501
Description LOB domain-containing protein 21
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G11090.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260123.88.7e-39111101100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+l+r+C++ C++apyf +++  +fa vhk+FGasnv+kll ++pee+r+++++sl+yeAe+r++dPvyG++g i +lq+++ +l+++la+++
  AT3G11090.1  11 SCAACKLLKRRCTPTCIFAPYFRSSDLITFAKVHKVFGASNVSKLLGEVPEEQRQETVNSLAYEAEVRLKDPVYGCIGAIASLQKKMLELQHDLAVAR 108
                  6*********************************************************************************************9998 PP

       DUF260  99 ee 100
                  ++
  AT3G11090.1 109 TR 110
                  75 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.67910111IPR004883Lateral organ boundaries, LOB
PfamPF031956.5E-3811108IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008150Biological Processbiological_process
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 165 aa     Download sequence    Send to blast
MRGHEPRSSS SCAACKLLKR RCTPTCIFAP YFRSSDLITF AKVHKVFGAS NVSKLLGEVP  60
EEQRQETVNS LAYEAEVRLK DPVYGCIGAI ASLQKKMLEL QHDLAVARTR LLAHSGVNNS  120
QVSPLDDSPE LAAFLDLVPY SDLMLLDGST NLDAYLYDLG QPPFV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A9e-4261156115LOB family transfactor Ramosa2.1
5ly0_B9e-4261156115LOB family transfactor Ramosa2.1
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO2402553240.0
Genevisible256427_at0.0
Expression AtlasAT3G11090-
AtGenExpressAT3G11090-
ATTED-IIAT3G11090-
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G11090.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G11090
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4738450.0AB473845.1 Arabidopsis thaliana ASL12 mRNA for ASYMMETRIC LEAVES2-like 12 protein, complete cds.
GenBankAC0733950.0AC073395.6 Arabidopsis thaliana chromosome 3 BAC F11B9 genomic sequence, complete sequence.
GenBankATAC0099910.0AC009991.5 Arabidopsis thaliana chromosome III BAC F9F8 genomic sequence, complete sequence.
GenBankCP0026860.0CP002686.1 Arabidopsis thaliana chromosome 3, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_187720.11e-119LOB domain-containing protein 21
SwissprotQ9SRL81e-120LBD21_ARATH; LOB domain-containing protein 21
TrEMBLA0A178V6L21e-118A0A178V6L2_ARATH; LBD21
STRINGAT3G11090.11e-119(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM102552735
Representative plantOGRP6016318
Publications ? help Back to Top
  1. Iwakawa H, et al.
    The ASYMMETRIC LEAVES2 gene of Arabidopsis thaliana, required for formation of a symmetric flat leaf lamina, encodes a member of a novel family of proteins characterized by cysteine repeats and a leucine zipper.
    Plant Cell Physiol., 2002. 43(5): p. 467-78
    [PMID:12040093]
  2. Shuai B,Reynaga-Peña CG,Springer PS
    The lateral organ boundaries gene defines a novel, plant-specific gene family.
    Plant Physiol., 2002. 129(2): p. 747-61
    [PMID:12068116]
  3. Weber AP,Weber KL,Carr K,Wilkerson C,Ohlrogge JB
    Sampling the Arabidopsis transcriptome with massively parallel pyrosequencing.
    Plant Physiol., 2007. 144(1): p. 32-42
    [PMID:17351049]
  4. Ascencio-Ib
    Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection.
    Plant Physiol., 2008. 148(1): p. 436-54
    [PMID:18650403]
  5. Matsumura Y,Iwakawa H,Machida Y,Machida C
    Characterization of genes in the ASYMMETRIC LEAVES2/LATERAL ORGAN BOUNDARIES (AS2/LOB) family in Arabidopsis thaliana, and functional and molecular comparisons between AS2 and other family members.
    Plant J., 2009. 58(3): p. 525-37
    [PMID:19154202]