PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G10500.1
Common NameAIF, ANAC053, F13M14.22, F18K10.7, NAC053, NTL4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 549aa    MW: 62356.1 Da    PI: 4.3715
Description NAC domain containing protein 53
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G10500.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM169.69.7e-5391361128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96 
                  l+pGfrFhPtdeelv +yLk+k+ +k++++ ++i+ +d+yk+ePwdLp k ++k+++ ewyfFs  dkky++g+++nrat+ gyWk+tgkd+e+l+ +
  AT3G10500.1   9 LAPGFRFHPTDEELVRYYLKRKICNKPFKF-DAISVTDVYKSEPWDLPdKsRLKSRDLEWYFFSMLDKKYRNGSKTNRATEMGYWKTTGKDREILN-G 104
                  579**************************9.99**************96347777888**************************************.9 PP

          NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                  +++vg+kktLv++kgrap+ge+t+Wvmheyrl
  AT3G10500.1 105 SKVVGMKKTLVYHKGRAPRGERTNWVMHEYRL 136
                  ******************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.05E-617159IPR003441NAC domain
PROSITE profilePS5100557.8569159IPR003441NAC domain
PfamPF023651.3E-2711136IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009819Biological Processdrought recovery
GO:0010150Biological Processleaf senescence
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000377Biological Processregulation of reactive oxygen species metabolic process
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0005789Cellular Componentendoplasmic reticulum membrane
GO:0005886Cellular Componentplasma membrane
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 549 aa     Download sequence    Send to blast
MGRGSVTSLA PGFRFHPTDE ELVRYYLKRK ICNKPFKFDA ISVTDVYKSE PWDLPDKSRL  60
KSRDLEWYFF SMLDKKYRNG SKTNRATEMG YWKTTGKDRE ILNGSKVVGM KKTLVYHKGR  120
APRGERTNWV MHEYRLVDQD LDKTGVHQDA FVLCRIFQKS GSGPKNGEQY GAPFVEEEWE  180
EEDDMTFVPD QEDLGSEDHV YVHMDDIDQK SENFVVYDAI PIPLNFIHGE SSNNVETNYS  240
DSINYIQQTG NYMDSGGYFE QPAESYEKDQ KPIIRDRDGS LQNEGIGCGV QDKHSETLQS  300
SDNIFGTDTS CYNDFPVESN YLIGEAFLDP NSNLLENDGL YLETNDLSST QQDGFDFEDY  360
LTFFDETFDP SQLMGNEDVF FDQEELFQEV ETKELEKEET SRSKHVVEEK EKDEASCSKQ  420
VDADATEFEP DYKYPLLKKA SHMLGAIPAP LANASEFPTK DAAIRLHAAQ SSGSVHVTAG  480
MITISDSNMG WSYGKNENLD LILSLGLVQG NTAPEKSGNS SAWAMLIFMC FWVLLLSVSF  540
KVSILVSSR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B2e-45816516171NAC domain-containing protein 19
4dul_A2e-45816516171NAC domain-containing protein 19
1ut7_B2e-45816516171NO APICAL MERISTEM PROTEIN
1ut7_A2e-45816516171NO APICAL MERISTEM PROTEIN
1ut4_B2e-45816516171NO APICAL MERISTEM PROTEIN
1ut4_A2e-45816516171NO APICAL MERISTEM PROTEIN
3swp_D2e-45816519174NAC domain-containing protein 19
3swp_C2e-45816519174NAC domain-containing protein 19
3swp_B2e-45816519174NAC domain-containing protein 19
3swp_A2e-45816519174NAC domain-containing protein 19
3swm_D2e-45816519174NAC domain-containing protein 19
3swm_C2e-45816519174NAC domain-containing protein 19
3swm_B2e-45816519174NAC domain-containing protein 19
3swm_A2e-45816519174NAC domain-containing protein 19
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1453383440.0
Genevisible258921_at0.0
Expression AtlasAT3G10500-
AtGenExpressAT3G10500-
ATTED-IIAT3G10500-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed in the anthers and the upper parts of the stamen filaments after stage 7 to 9 of flower budding. In stage 10 flower buds, expressed in the anthers and pollen grains. Weakly expressed in mature flowers at stage 12. {ECO:0000269|PubMed:24323506}.
UniprotTISSUE SPECIFICITY: Expressed in roots, rosette leaves, cauline leaves, shoot apex and stems. {ECO:0000269|PubMed:17158162}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP) (Ref.6, PubMed:24323506, PubMed:25219309). Promotes reactive oxygen species (ROS) production during drought-induced leaf senescence. In response to abscisic acid (ABA)-mediated drought stress signals, binds directly to the promoters of RBOHC and RBOHE genes, encoding ROS biosynthetic enzymes, resulting in ROS accumulation and triggering leaf senescence via programmed cell death (PCD). ROS-induced leaf senescence sustains plant survival under drought conditions (PubMed:22313226). Involved in heat stress response. Modulates PCD through a ROS-mediated positive feedback control under heat stress conditions. This may provide an adaptation strategy for plant survival under extreme heat stress conditions (PubMed:25219309). Acts as repressor in preventing anther dehiscence during stamen development by suppressing genes that participate in jasmonic acid (JA) biosynthesis, such as DAD1, AOS, AOC3, OPR3 and 4CLL5/OPCL1 (PubMed:24323506). {ECO:0000269|PubMed:22313226, ECO:0000269|PubMed:24323506, ECO:0000269|PubMed:25219309, ECO:0000269|Ref.6}.
Function -- GeneRIF ? help Back to Top
  1. NTL4 acts as a molecular switch that couples ROS metabolism to drought-induced leaf senescence.
    [PMID: 22313226]
  2. The present data suggest a role for AIF in controlling anther dehiscence by suppressing the expression of jasmonic acid biosynthesis genes in Arabidopsis.
    [PMID: 24323506]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00343DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G10500.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By abscisic acid (ABA) (PubMed:22313226, PubMed:25219309). Induced by heat shock (PubMed:25219309). Induced by cold, drought stress and methyl methanesulfonate (MMS) treatment (PubMed:17158162). {ECO:0000269|PubMed:17158162, ECO:0000269|PubMed:22313226, ECO:0000269|PubMed:25219309}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Disruption Phenotype ? help Back to Top
Source Description
UniProtDISRUPTION PHENOTYPE: Delayed leaf senescence and enhanced drought resistance (PubMed:22313226). Enhanced heat resistance (PubMed:25219309). {ECO:0000269|PubMed:22313226, ECO:0000269|PubMed:25219309}.
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G10500
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0793450.0AY079345.1 Arabidopsis thaliana unknown protein (At3g10500) mRNA, complete cds.
GenBankAY0510030.0AY051003.1 Arabidopsis thaliana unknown protein (At3g10500) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_566376.10.0NAC domain containing protein 53
SwissprotQ949N00.0NAC53_ARATH; NAC domain-containing protein 53
TrEMBLD7L8Z70.0D7L8Z7_ARALL; ANAC053
STRINGAT3G10500.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1057159
MalvidsOGEM31922762
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  3. Ooka H, et al.
    Comprehensive analysis of NAC family genes in Oryza sativa and Arabidopsis thaliana.
    DNA Res., 2003. 10(6): p. 239-47
    [PMID:15029955]
  4. Hampton CR, et al.
    Cesium toxicity in Arabidopsis.
    Plant Physiol., 2004. 136(3): p. 3824-37
    [PMID:15489280]
  5. Baerson SR, et al.
    Detoxification and transcriptome response in Arabidopsis seedlings exposed to the allelochemical benzoxazolin-2(3H)-one.
    J. Biol. Chem., 2005. 280(23): p. 21867-81
    [PMID:15824099]
  6. Ohashi-Ito K,Kubo M,Demura T,Fukuda H
    Class III homeodomain leucine-zipper proteins regulate xylem cell differentiation.
    Plant Cell Physiol., 2005. 46(10): p. 1646-56
    [PMID:16081527]
  7. Davletova S,Schlauch K,Coutu J,Mittler R
    The zinc-finger protein Zat12 plays a central role in reactive oxygen and abiotic stress signaling in Arabidopsis.
    Plant Physiol., 2005. 139(2): p. 847-56
    [PMID:16183833]
  8. Lee BH,Henderson DA,Zhu JK
    The Arabidopsis cold-responsive transcriptome and its regulation by ICE1.
    Plant Cell, 2005. 17(11): p. 3155-75
    [PMID:16214899]
  9. Vergnolle C, et al.
    The cold-induced early activation of phospholipase C and D pathways determines the response of two distinct clusters of genes in Arabidopsis cell suspensions.
    Plant Physiol., 2005. 139(3): p. 1217-33
    [PMID:16258011]
  10. Lindqvist C, et al.
    An expressed sequence tag (EST) library from developing fruits of an Hawaiian endemic mint (Stenogyne rugosa, Lamiaceae): characterization and microsatellite markers.
    BMC Plant Biol., 2006. 6: p. 16
    [PMID:16928278]
  11. Kim SY, et al.
    Exploring membrane-associated NAC transcription factors in Arabidopsis: implications for membrane biology in genome regulation.
    Nucleic Acids Res., 2007. 35(1): p. 203-13
    [PMID:17158162]
  12. Culligan KM,Robertson CE,Foreman J,Doerner P,Britt AB
    ATR and ATM play both distinct and additive roles in response to ionizing radiation.
    Plant J., 2006. 48(6): p. 947-61
    [PMID:17227549]
  13. Fleury D, et al.
    The Arabidopsis thaliana homolog of yeast BRE1 has a function in cell cycle regulation during early leaf and root growth.
    Plant Cell, 2007. 19(2): p. 417-32
    [PMID:17329565]
  14. Ascencio-Ib
    Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection.
    Plant Physiol., 2008. 148(1): p. 436-54
    [PMID:18650403]
  15. Inz
    A subcellular localization compendium of hydrogen peroxide-induced proteins.
    Plant Cell Environ., 2012. 35(2): p. 308-20
    [PMID:21443605]
  16. Lee S,Seo PJ,Lee HJ,Park CM
    A NAC transcription factor NTL4 promotes reactive oxygen species production during drought-induced leaf senescence in Arabidopsis.
    Plant J., 2012. 70(5): p. 831-44
    [PMID:22313226]
  17. Lee S,Park CM
    Regulation of reactive oxygen species generation under drought conditions in Arabidopsis.
    Plant Signal Behav, 2012. 7(6): p. 599-601
    [PMID:22580707]
  18. Shih CF,Hsu WH,Peng YJ,Yang CH
    The NAC-like gene ANTHER INDEHISCENCE FACTOR acts as a repressor that controls anther dehiscence by regulating genes in the jasmonate biosynthesis pathway in Arabidopsis.
    J. Exp. Bot., 2014. 65(2): p. 621-39
    [PMID:24323506]
  19. Lee S, et al.
    The Arabidopsis NAC transcription factor NTL4 participates in a positive feedback loop that induces programmed cell death under heat stress conditions.
    Plant Sci., 2014. 227: p. 76-83
    [PMID:25219309]