PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G10490.2
Common NameANAC051, ANAC052, F13M14.23, F18K10.6, NAC052
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 451aa    MW: 51291.3 Da    PI: 5.4164
Description NAC domain containing protein 52
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G10490.2genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM165.91.4e-51271541128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96 
                  l+pGfrFhPtdeelv++yLk+kv g+++++ ++i evdiyk+ePwdL   +++k++++ewyf+s  dkky +g r nrat++gyWkatgkd+e+ + +
  AT3G10490.2  27 LAPGFRFHPTDEELVSYYLKRKVLGQPVRF-DAIGEVDIYKHEPWDLAvfSRLKTRDQEWYFYSALDKKYGNGARMNRATNRGYWKATGKDREIRR-D 122
                  579************************999.99**************8544899999*************************************99.9 PP

          NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                    l g+kktLvf++grap+g +t+Wvmheyrl
  AT3G10490.2 123 ILLLGMKKTLVFHSGRAPDGLRTNWVMHEYRL 154
                  999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.14E-5923179IPR003441NAC domain
PROSITE profilePS5100556.88427178IPR003441NAC domain
PfamPF023651.7E-2629154IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006351Biological Processtranscription, DNA-templated
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009555Biological Processpollen development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005730Cellular Componentnucleolus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000293anatomyguard cell
Sequence ? help Back to Top
Protein Sequence    Length: 451 aa     Download sequence    Send to blast
MGRESVAVVT APPSATAPGT ASVATSLAPG FRFHPTDEEL VSYYLKRKVL GQPVRFDAIG  60
EVDIYKHEPW DLAVFSRLKT RDQEWYFYSA LDKKYGNGAR MNRATNRGYW KATGKDREIR  120
RDILLLGMKK TLVFHSGRAP DGLRTNWVMH EYRLVEYETE KNGNLVQDAY VLCRVFHKNN  180
IGPPSGNRYA PFMEEEWADD EGALIPGIDV KLRLEPPPVA NGNDQMDQEI QSASKSLINI  240
NEPPRETAPL DIESDQQNHH ENDLKPEEHN NNNNYDENEE TLKREQMEEE ERPPRPVCVL  300
NKEAPLPLLQ YKRRRQSESN NNSSRNTQDH CSSTTTTVDN TTTLISSSAA ATNTAISALL  360
EFSLMGISDK KEKPQQPLRP HKEPLPPQTP LASPEEKVND LQKEIHQMSV ERETFKLEMM  420
SAEAMISILQ SRIDALRQEN EELKKNNANG Q
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A7e-472618016167NO APICAL MERISTEM PROTEIN
1ut4_B7e-472618016167NO APICAL MERISTEM PROTEIN
1ut7_A7e-472618016167NO APICAL MERISTEM PROTEIN
1ut7_B7e-472618016167NO APICAL MERISTEM PROTEIN
3swm_A7e-472618019170NAC domain-containing protein 19
3swm_B7e-472618019170NAC domain-containing protein 19
3swm_C7e-472618019170NAC domain-containing protein 19
3swm_D7e-472618019170NAC domain-containing protein 19
3swp_A7e-472618019170NAC domain-containing protein 19
3swp_B7e-472618019170NAC domain-containing protein 19
3swp_C7e-472618019170NAC domain-containing protein 19
3swp_D7e-472618019170NAC domain-containing protein 19
4dul_A7e-472618016167NAC domain-containing protein 19
4dul_B7e-472618016167NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.209930.0flower| root| seed| silique
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible258926_s_at0.0
Expression AtlasAT3G10490-
AtGenExpressAT3G10490-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Mostly expressed in floral organs, and, at low levels, in other organs. {ECO:0000269|PubMed:25578968}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional repressor that binds to the motif 5'-(C/T)A(C/A)G-3' in the promoter of target genes (PubMed:25578968). Binds also to the 5'-CTTGNNNNNCAAG-3' consensus sequence in chromatin (PubMed:26617990). Can bind to the mitochondrial dysfunction motif (MDM) present in the upstream regions of mitochondrial dysfunction stimulon (MDS) genes involved in mitochondrial retrograde regulation (MRR) (PubMed:24045019). Together with NAC050 and JMJ14, regulates gene expression and flowering time by associating with the histone demethylase JMJ14, probably by the promotion of RNA-mediated gene silencing (PubMed:25578968, PubMed:26617990). Regulates siRNA-dependent post-transcriptional gene silencing (PTGS) through SGS3 expression modulation (PubMed:28207953). Required during pollen development (PubMed:19237690). {ECO:0000269|PubMed:19237690, ECO:0000269|PubMed:24045019, ECO:0000269|PubMed:25578968, ECO:0000269|PubMed:26617990, ECO:0000269|PubMed:28207953}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00612ChIP-seqSRX669382Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G10490.2
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by type III effector proteins (TTEs) secreted by the pathogenic bacteria P.syringae pv. tomato DC3000 during basal defense. {ECO:0000269|PubMed:16553893}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G10490
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0597640.0AY059764.1 Arabidopsis thaliana At3g10490 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_850554.10.0NAC domain containing protein 52
SwissprotQ9SQY00.0NAC52_ARATH; NAC domain containing protein 52
TrEMBLA0A178VCW10.0A0A178VCW1_ARATH; NAC052
STRINGAT3G10490.20.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17802880
Representative plantOGRP1087158
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Ooka H, et al.
    Comprehensive analysis of NAC family genes in Oryza sativa and Arabidopsis thaliana.
    DNA Res., 2003. 10(6): p. 239-47
    [PMID:15029955]
  3. Pendle AF, et al.
    Proteomic analysis of the Arabidopsis nucleolus suggests novel nucleolar functions.
    Mol. Biol. Cell, 2005. 16(1): p. 260-9
    [PMID:15496452]
  4. Truman W,de Zabala MT,Grant M
    Type III effectors orchestrate a complex interplay between transcriptional networks to modify basal defence responses during pathogenesis and resistance.
    Plant J., 2006. 46(1): p. 14-33
    [PMID:16553893]
  5. Boavida LC, et al.
    A collection of Ds insertional mutants associated with defects in male gametophyte development and function in Arabidopsis thaliana.
    Genetics, 2009. 181(4): p. 1369-85
    [PMID:19237690]
  6. Higgins JD,Ferdous M,Osman K,Franklin FC
    The RecQ helicase AtRECQ4A is required to remove inter-chromosomal telomeric connections that arise during meiotic recombination in Arabidopsis.
    Plant J., 2011. 65(3): p. 492-502
    [PMID:21265901]
  7. Causier B,Ashworth M,Guo W,Davies B
    The TOPLESS interactome: a framework for gene repression in Arabidopsis.
    Plant Physiol., 2012. 158(1): p. 423-38
    [PMID:22065421]
  8. De Clercq I, et al.
    The membrane-bound NAC transcription factor ANAC013 functions in mitochondrial retrograde regulation of the oxidative stress response in Arabidopsis.
    Plant Cell, 2013. 25(9): p. 3472-90
    [PMID:24045019]
  9. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  10. Ning YQ, et al.
    Two novel NAC transcription factors regulate gene expression and flowering time by associating with the histone demethylase JMJ14.
    Nucleic Acids Res., 2015. 43(3): p. 1469-84
    [PMID:25578968]
  11. Zhang S, et al.
    C-terminal domains of a histone demethylase interact with a pair of transcription factors and mediate specific chromatin association.
    Cell Discov, 2019.
    [PMID:26617990]
  12. Butel N,Le Masson I,Bouteiller N,Vaucheret H,Elmayan T
    sgs1: a neomorphic nac52 allele impairing post-transcriptional gene silencing through SGS3 downregulation.
    Plant J., 2017. 90(3): p. 505-519
    [PMID:28207953]
  13. Elmayan T, et al.
    Arabidopsis mutants impaired in cosuppression.
    Plant Cell, 1998. 10(10): p. 1747-58
    [PMID:9761800]