PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G10480.2
Common NameANAC050, NAC050
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 446aa    MW: 50227.1 Da    PI: 5.6675
Description NAC domain containing protein 50
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G10480.2genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM170.45.7e-53271541128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96 
                  l+pGfrFhPtdeelv++yLk+kv gk++++ ++i evdiyk+ePwdL   +k+k++++ewyfFs  dkky +g r nrat++gyWkatgkd+e+ + +
  AT3G10480.2  27 LAPGFRFHPTDEELVSYYLKRKVLGKPVRF-DAIGEVDIYKHEPWDLAvfSKLKTRDQEWYFFSALDKKYGNGARMNRATNKGYWKATGKDREIRR-D 122
                  579************************999.99**************8544999999**************************************9.9 PP

          NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                   +l g+kktLvf++grap+g +t+Wvmheyrl
  AT3G10480.2 123 IQLLGMKKTLVFHSGRAPDGLRTNWVMHEYRL 154
                  99****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.7E-6020178IPR003441NAC domain
PROSITE profilePS5100557.44227177IPR003441NAC domain
PfamPF023651.4E-2729154IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000005anatomycultured plant cell
PO:0000293anatomyguard cell
Sequence ? help Back to Top
Protein Sequence    Length: 446 aa     Download sequence    Send to blast
MGRESLAVVS SPPSATAPST AVSATSLAPG FRFHPTDEEL VSYYLKRKVL GKPVRFDAIG  60
EVDIYKHEPW DLAVFSKLKT RDQEWYFFSA LDKKYGNGAR MNRATNKGYW KATGKDREIR  120
RDIQLLGMKK TLVFHSGRAP DGLRTNWVMH EYRLVEYETE TNGSLLDAYV LCRVFHKNNI  180
GPPSGNRYAP FMEEEWADGG GALIPGIDVR VRVEALPQAN GNNQMDQEMH SASKDLININ  240
ELPRDATPMD IEPNQQNHHE SAFKPQESNN HSGYEEDEDT LKREHAEEDE RPPSLCILNK  300
EAPLPLLQYK RRRQNESNNN SSRNTQDHCS STITTVDNTT TLISSSAAAA TNTAISALLE  360
FSLMGISDKK ENQQKEETSP PSPIASPEEK VNDLQKEVHQ MSVERETFKL EMMSAEAMIS  420
ILQSRIDALR QENEELKKKN ASGQAS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swp_D3e-492217915170NAC domain-containing protein 19
3swp_C3e-492217915170NAC domain-containing protein 19
3swp_B3e-492217915170NAC domain-containing protein 19
3swp_A3e-492217915170NAC domain-containing protein 19
3swm_D3e-492217915170NAC domain-containing protein 19
3swm_C3e-492217915170NAC domain-containing protein 19
3swm_B3e-492217915170NAC domain-containing protein 19
3swm_A3e-492217915170NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.201140.0flower| silique
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible258926_s_at1e-169
Expression AtlasAT3G10480-
AtGenExpressAT3G10480-
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00342DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G10480.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Interaction ? help Back to Top
Source Intact With
BioGRIDAT3G10480, AT3G10490, AT1G14920
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G10480
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0912620.0AY091262.1 Arabidopsis thaliana unknown protein (At3g10480) mRNA, complete cds.
GenBankAY0597950.0AY059795.1 Arabidopsis thaliana unknown protein (At3g10480) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_974272.10.0NAC domain containing protein 50
TrEMBLF4J3S80.0F4J3S8_ARATH; NAC domain containing protein 50
STRINGfgenesh1_pm.C_scaffold_30008640.0(Arabidopsis lyrata)
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Ooka H, et al.
    Comprehensive analysis of NAC family genes in Oryza sativa and Arabidopsis thaliana.
    DNA Res., 2003. 10(6): p. 239-47
    [PMID:15029955]
  3. Ishihara T, et al.
    Comparative analysis of expressed sequence tags in resistant and susceptible ecotypes of Arabidopsis thaliana infected with cucumber mosaic virus.
    Plant Cell Physiol., 2004. 45(4): p. 470-80
    [PMID:15111722]
  4. Arabidopsis Interactome Mapping Consortium
    Evidence for network evolution in an Arabidopsis interactome map.
    Science, 2011. 333(6042): p. 601-7
    [PMID:21798944]
  5. Causier B,Ashworth M,Guo W,Davies B
    The TOPLESS interactome: a framework for gene repression in Arabidopsis.
    Plant Physiol., 2012. 158(1): p. 423-38
    [PMID:22065421]
  6. De Clercq I, et al.
    The membrane-bound NAC transcription factor ANAC013 functions in mitochondrial retrograde regulation of the oxidative stress response in Arabidopsis.
    Plant Cell, 2013. 25(9): p. 3472-90
    [PMID:24045019]
  7. Mar
    Large-scale identification of gibberellin-related transcription factors defines group VII ETHYLENE RESPONSE FACTORS as functional DELLA partners.
    Plant Physiol., 2014. 166(2): p. 1022-32
    [PMID:25118255]
  8. Ning YQ, et al.
    Two novel NAC transcription factors regulate gene expression and flowering time by associating with the histone demethylase JMJ14.
    Nucleic Acids Res., 2015. 43(3): p. 1469-84
    [PMID:25578968]