PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G09600.1
Common NameF11F8.19, LCL5, RVE8
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB_related
Protein Properties Length: 298aa    MW: 32801.1 Da    PI: 9.7919
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G09600.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.73.2e-144387147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r +WT+eE++++++a +++  + Wk+I   +g  +t  q++s+ qky
      AT3G09600.1 43 RESWTEEEHDKFLEALQLFDRD-WKKIEDFVG-SKTVIQIRSHAQKY 87
                     789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.27E-173793IPR009057Homeodomain-like
PROSITE profilePS5129416.2913892IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.7E-74193IPR009057Homeodomain-like
TIGRFAMsTIGR015578.9E-194190IPR006447Myb domain, plants
SMARTSM007171.1E-114290IPR001005SANT/Myb domain
PfamPF002497.1E-124387IPR001005SANT/Myb domain
CDDcd001672.29E-94588No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0032922Biological Processcircadian regulation of gene expression
GO:0043966Biological Processhistone H3 acetylation
GO:0046686Biological Processresponse to cadmium ion
GO:0048573Biological Processphotoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 298 aa     Download sequence    Send to blast
MSSSPSRNPT NAEAPPPPPT STDAVAEGSS KKVRKPYTIT KSRESWTEEE HDKFLEALQL  60
FDRDWKKIED FVGSKTVIQI RSHAQKYFLK VQKNGTLAHV PPPRPKRKAA HPYPQKASKN  120
AQMPLQVSTS FTTTRNGDMP GYASWDDASM LLNRVISPQH ELATLRGAEA DIGSKGLLNV  180
SSPSTSGMGS SSRTVSGSEI VRKAKQPPVL HGVPDFAEVY NFIGSVFDPE TRGHVEKLKE  240
MDPINFETVL LLMRNLTVNL SNPDLESTRK VLLSYDNVTT ELPSVVSLVK NSTSDKSA
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO202687040.0
Genevisible258723_at1e-176
Expression AtlasAT3G09600-
AtGenExpressAT3G09600-
ATTED-IIAT3G09600-
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator of evening element (EE)-containing clock-controlled genes. Forms a negative feedback loop with APRR5. Regulates the pattern of histone H3 acetylation of the TOC1 promoter. {ECO:0000269|PubMed:21205033, ECO:0000269|PubMed:21474993, ECO:0000269|PubMed:21483796, ECO:0000269|PubMed:23638299}.
Function -- GeneRIF ? help Back to Top
  1. RVE8/LCL5 expression shows a rhythmic oscillation that is controlled by the circadian clock. Alteration of RVE8/LCL5 expression affects the photoperiodic regulation of flowering time.
    [PMID: 21205033]
  2. RVE8/LCL5 binds to the promoter of key clock component TOC1 (Timing of CAB expression 1) and regulates its circadian expression.
    [PMID: 21474993]
  3. RVE8 is a new component of the plant circadian oscillator that takes part in a novel transcriptional feedback loop. [REVEILLE 8] [RVE8].
    [PMID: 21483796]
  4. RVE8 affects Global Circadian-regulated transcription. Long-period mutant in Arabidopsis, rve8-1, has a global alteration in phase of all clock-controlled genes. [RVE8]
    [PMID: 23185460]
  5. This study defines a switch in the regulatory activity of RVE8-LNK interaction, from a synergic coactivating role of evening-expressed clock genes to a repressive antagonistic function modulating anthocyanin biosynthesis around midday.
    [PMID: 25848001]
  6. REVEILLE clock genes rve3 4 5 6 8 mutants are much larger than wild-type plants, with both increased leaf area and biomass.
    [PMID: 28254761]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00338DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G09600.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Circadian-regulation. Peak of expression in the afternoon. Down-regulated by cold. {ECO:0000269|PubMed:21205033, ECO:0000269|PubMed:22902701, ECO:0000269|PubMed:23638299}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDabscisic acid, auxin, ethylene, gibberellin, jasmonic acid, salicylic acid
Phenotype -- Disruption Phenotype ? help Back to Top
Source Description
UniProtDISRUPTION PHENOTYPE: Delay and reduction in levels of evening-phased clock gene transcripts and long circadian period. {ECO:0000269|PubMed:21483796, ECO:0000269|PubMed:23638299}.
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G09600
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0911060.0AY091106.1 Arabidopsis thaliana unknown protein (At3g09600) mRNA, complete cds.
GenBankAY1229690.0AY122969.1 Arabidopsis thaliana unknown protein (At3g09600) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001327348.10.0Homeodomain-like superfamily protein
RefseqNP_187571.20.0Homeodomain-like superfamily protein
SwissprotQ8RWU30.0RVE8_ARATH; Protein REVEILLE 8
TrEMBLD7L8A70.0D7L8A7_ARALL; Myb family transcription factor
STRINGAT3G09600.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM93032633
Representative plantOGRP9281558
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Dal Bosco C, et al.
    Inactivation of the chloroplast ATP synthase gamma subunit results in high non-photochemical fluorescence quenching and altered nuclear gene expression in Arabidopsis thaliana.
    J. Biol. Chem., 2004. 279(2): p. 1060-9
    [PMID:14576160]
  3. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  4. Rizhsky L,Davletova S,Liang H,Mittler R
    The zinc finger protein Zat12 is required for cytosolic ascorbate peroxidase 1 expression during oxidative stress in Arabidopsis.
    J. Biol. Chem., 2004. 279(12): p. 11736-43
    [PMID:14722088]
  5. S
    ABA activates ADPR cyclase and cADPR induces a subset of ABA-responsive genes in Arabidopsis.
    Plant J., 2004. 38(3): p. 381-95
    [PMID:15086800]
  6. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  7. Gutierrez L, et al.
    Identification of new gene expression regulators specifically expressed during plant seed maturation.
    J. Exp. Bot., 2006. 57(9): p. 1919-32
    [PMID:16606634]
  8. Manfield IW, et al.
    Arabidopsis Co-expression Tool (ACT): web server tools for microarray-based gene expression analysis.
    Nucleic Acids Res., 2006. 34(Web Server issue): p. W504-9
    [PMID:16845059]
  9. Lee DJ, et al.
    Genome-wide expression profiling of ARABIDOPSIS RESPONSE REGULATOR 7(ARR7) overexpression in cytokinin response.
    Mol. Genet. Genomics, 2007. 277(2): p. 115-37
    [PMID:17061125]
  10. Ascencio-Ib
    Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection.
    Plant Physiol., 2008. 148(1): p. 436-54
    [PMID:18650403]
  11. Agudelo-Romero P, et al.
    Changes in the gene expression profile of Arabidopsis thaliana after infection with Tobacco etch virus.
    Virol. J., 2008. 5: p. 92
    [PMID:18684336]
  12. Rawat R, et al.
    REVEILLE1, a Myb-like transcription factor, integrates the circadian clock and auxin pathways.
    Proc. Natl. Acad. Sci. U.S.A., 2009. 106(39): p. 16883-8
    [PMID:19805390]
  13. Farinas B,Mas P
    Functional implication of the MYB transcription factor RVE8/LCL5 in the circadian control of histone acetylation.
    Plant J., 2011. 66(2): p. 318-29
    [PMID:21205033]
  14. Farinas B,Mas P
    Histone acetylation and the circadian clock: a role for the MYB transcription factor RVE8/LCL5.
    Plant Signal Behav, 2011. 6(4): p. 541-3
    [PMID:21474993]
  15. Rawat R, et al.
    REVEILLE8 and PSEUDO-REPONSE REGULATOR5 form a negative feedback loop within the Arabidopsis circadian clock.
    PLoS Genet., 2011. 7(3): p. e1001350
    [PMID:21483796]
  16. James AB,Syed NH,Brown JW,Nimmo HG
    Thermoplasticity in the plant circadian clock: how plants tell the time-perature.
    Plant Signal Behav, 2012. 7(10): p. 1219-23
    [PMID:22902701]
  17. Hsu PY,Harmer SL
    Circadian phase has profound effects on differential expression analysis.
    PLoS ONE, 2012. 7(11): p. e49853
    [PMID:23185460]
  18. Hsu PY,Devisetty UK,Harmer SL
    Accurate timekeeping is controlled by a cycling activator in Arabidopsis.
    Elife, 2013. 2: p. e00473
    [PMID:23638299]
  19. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  20. Xie Q, et al.
    LNK1 and LNK2 are transcriptional coactivators in the Arabidopsis circadian oscillator.
    Plant Cell, 2014. 26(7): p. 2843-57
    [PMID:25012192]
  21. Fogelmark K,Troein C
    Rethinking transcriptional activation in the Arabidopsis circadian clock.
    PLoS Comput. Biol., 2014. 10(7): p. e1003705
    [PMID:25033214]
  22. P
    Time-dependent sequestration of RVE8 by LNK proteins shapes the diurnal oscillation of anthocyanin biosynthesis.
    Proc. Natl. Acad. Sci. U.S.A., 2015. 112(16): p. 5249-53
    [PMID:25848001]
  23. Xing H, et al.
    LNK1 and LNK2 recruitment to the evening element require morning expressed circadian related MYB-like transcription factors.
    Plant Signal Behav, 2015. 10(3): p. e1010888
    [PMID:25848708]
  24. Gray JA,Shalit-Kaneh A,Chu DN,Hsu PY,Harmer SL
    The REVEILLE Clock Genes Inhibit Growth of Juvenile and Adult Plants by Control of Cell Size.
    Plant Physiol., 2017. 173(4): p. 2308-2322
    [PMID:28254761]