PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G09370.1
Common NameAtMYB3R3, MYB3R-3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 505aa    MW: 56119 Da    PI: 7.833
Description myb domain protein 3r-3
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G09370.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.89.4e-1778124148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WT+eEde l +av  + g++Wk Ia+ ++  Rt+ qc +rwqk+l
      AT3G09370.1  78 KGGWTPEEDETLRQAVDTFKGKSWKNIAKSFP-DRTEVQCLHRWQKVL 124
                      688*****************************.************986 PP

2Myb_DNA-binding60.34.2e-19130176148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+WT eEde++v++v+++G+  W+ Ia+ ++ gR +kqc++rw+++l
      AT3G09370.1 130 KGPWTHEEDEKIVELVEKYGPAKWSIIAQSLP-GRIGKQCRERWHNHL 176
                      79******************************.*************97 PP

3Myb_DNA-binding55.11.7e-17182225146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +++WTteE+  l +a++ +G++ W+ Ia+ ++ gRt++ +k++w++
      AT3G09370.1 182 KDAWTTEEEVALMNAHRSHGNK-WAEIAKVLP-GRTDNAIKNHWNS 225
                      679*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.20273124IPR017930Myb domain
SMARTSM007172.5E-1477126IPR001005SANT/Myb domain
PfamPF002492.0E-1578124IPR001005SANT/Myb domain
SuperFamilySSF466891.08E-1579134IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.2E-2080134IPR009057Homeodomain-like
CDDcd001676.01E-1381124No hitNo description
PROSITE profilePS5129432.202125180IPR017930Myb domain
SuperFamilySSF466894.12E-32127223IPR009057Homeodomain-like
SMARTSM007172.0E-17129178IPR001005SANT/Myb domain
CDDcd001672.24E-15132176No hitNo description
PfamPF139212.5E-18133190No hitNo description
Gene3DG3DSA:1.10.10.602.2E-27135183IPR009057Homeodomain-like
SMARTSM007179.4E-16181229IPR001005SANT/Myb domain
PROSITE profilePS5129421.811181231IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.1E-23184230IPR009057Homeodomain-like
CDDcd001673.69E-12184227No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0030154Biological Processcell differentiation
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000084anatomyplant sperm cell
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 505 aa     Download sequence    Send to blast
MSSTFNPAAS SPDEEETGEV KIEDQCVENK QSTPASCSSV SEGSAGSSHK SPTIASPATV  60
SPTHRYLGRT SGPIRRAKGG WTPEEDETLR QAVDTFKGKS WKNIAKSFPD RTEVQCLHRW  120
QKVLNPDLIK GPWTHEEDEK IVELVEKYGP AKWSIIAQSL PGRIGKQCRE RWHNHLNPDI  180
NKDAWTTEEE VALMNAHRSH GNKWAEIAKV LPGRTDNAIK NHWNSSLKKK SEFYLLTGRL  240
PPPTTTRNGV PDSVTKRSSS AQKRVFGSVA QTSSVTTDVN NLAEDGNGQI NSSVPVEEVV  300
AASRMTSLNE YARSPQLPNP EPLPENGGAA NNGYHLYYTP QIDYYRASEV DTQRMYGNEC  360
GCSPSASPVS FFTPPPCRNV HSNGSTPRSP ESYLREAGRT YPNTPSIFRK RRPRVVVQDN  420
NNAKKTDEAK EVDQKVNDGK DSSEIQNNGS NAYNLSPPYR IRSKRTAVFK SRQLEFISRE  480
EEKADDETKS SEKDMLIDGD SQLLG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h89_C8e-70772305158MYB PROTO-ONCOGENE PROTEIN
1h88_C8e-70772305158MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.118890.0flower
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO143345810.0
Genevisible259007_at0.0
Expression AtlasAT3G09370-
AtGenExpressAT3G09370-
ATTED-IIAT3G09370-
Functional Description ? help Back to Top
Source Description
TAIRputative c-myb-like transcription factor (MYB3R3) mRNA,
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G09370.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G09370
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5196510.0AY519651.1 Arabidopsis thaliana MYB transcription factor (At3g09370) mRNA, complete cds.
GenBankAY1426490.0AY142649.1 Arabidopsis thaliana putative MYB family transcription factor (At3g09370) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_566350.10.0c-myb-like transcription factor MYB3R3
TrEMBLQ8H1P90.0Q8H1P9_ARATH; C-myb-like transcription factor MYB3R3
STRINGAT3G09370.20.0(Arabidopsis thaliana)
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  3. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  4. Haga N, et al.
    R1R2R3-Myb proteins positively regulate cytokinesis through activation of KNOLLE transcription in Arabidopsis thaliana.
    Development, 2007. 134(6): p. 1101-10
    [PMID:17287251]
  5. Arabidopsis Interactome Mapping Consortium
    Evidence for network evolution in an Arabidopsis interactome map.
    Science, 2011. 333(6042): p. 601-7
    [PMID:21798944]