PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G08500.1
Common NameAtMYB83, MYB83, T8G24.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 343aa    MW: 38418.8 Da    PI: 6.0972
Description myb domain protein 83
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G08500.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.93e-153279148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W+++Ede+l+++    G g+W+ Iar  g+ R++k+c++rw +yl
      AT3G08500.1 32 KGLWSPDEDEKLIRYMLTNGQGCWSDIARNAGLLRCGKSCRLRWINYL 79
                     678*****************************99************97 PP

2Myb_DNA-binding48.12.7e-1585129147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+++++E++l+ +++  lG++ W+ Ia +++ gRt++++k++w++ 
      AT3G08500.1  85 RGSFSPQEEDLIFHLHSILGNR-WSQIATRLP-GRTDNEIKNFWNST 129
                      899*******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.8E-222682IPR009057Homeodomain-like
PROSITE profilePS5129417.3092779IPR017930Myb domain
SuperFamilySSF466891.15E-2729126IPR009057Homeodomain-like
SMARTSM007171.7E-123181IPR001005SANT/Myb domain
PfamPF002496.7E-143279IPR001005SANT/Myb domain
CDDcd001671.98E-103579No hitNo description
PROSITE profilePS5129424.98480134IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.2E-2583135IPR009057Homeodomain-like
SMARTSM007171.4E-1584132IPR001005SANT/Myb domain
PfamPF002494.4E-1485129IPR001005SANT/Myb domain
CDDcd001674.76E-1187130No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0030154Biological Processcell differentiation
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 343 aa     Download sequence    Send to blast
MMMRKPDITT IRDKGKPNHA CGGNNNKPKL RKGLWSPDED EKLIRYMLTN GQGCWSDIAR  60
NAGLLRCGKS CRLRWINYLR PDLKRGSFSP QEEDLIFHLH SILGNRWSQI ATRLPGRTDN  120
EIKNFWNSTL KKRLKNNSNN NTSSGSSPNN SNSNSLDPRD QHVDMGGNST SLMDDYHHDE  180
NMMTVGNTMR MDSSSPFNVG PMVNSVGLNQ LYDPLMISVP DNGYHQMGNT VNVFSVNGLG  240
DYGNTILDPI SKRVSVEGDD WFIPPSENTN VIACSTSNNL NLQALDPCFN SKNLCHSESF  300
KVGNVLGIEN GSWEIENPKI GDWDLDGLID NNSSFPFLDF QVD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-29281343108B-MYB
1h8a_C6e-292813423128MYB TRANSFORMING PROTEIN
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible256155_at0.0
Expression AtlasAT3G08500-
AtGenExpressAT3G08500-
ATTED-IIAT3G08500-
Functional Description ? help Back to Top
Source Description
TAIREncodes a putative R2R3-type MYB transcription factor (MYB83).
Function -- GeneRIF ? help Back to Top
  1. MYB83 and MYB46, both of which are SND1 direct targets, function redundantly in the transcriptional regulatory cascade leading to secondary wall formation in fibers and vessels.
    [PMID: 19808805]
  2. MYB83 binds to secondary wall MYB-responsive elements and activates the same direct target genes as MYB46. MYB46 and MYB83 directly activate a set of downstream transcription factors.
    [PMID: 22197883]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00336DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G08500.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G08500
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ4466450.0DQ446645.1 Arabidopsis thaliana clone pENTR221-At3g08500 myb family transcription factor (At3g08500) mRNA, complete cds.
GenBankBT0265060.0BT026506.1 Arabidopsis thaliana At3g08500 mRNA, complete cds.
GenBankAF3719740.0AF371974.1 Arabidopsis thaliana putative transcription factor MYB83 (MYB83) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_187463.10.0myb domain protein 83
TrEMBLQ9C6U10.0Q9C6U1_ARATH; At3g08500
STRINGAT3G08500.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
MalvidsOGEM70772642
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  3. Becher M,Talke IN,Krall L,Kr
    Cross-species microarray transcript profiling reveals high constitutive expression of metal homeostasis genes in shoots of the zinc hyperaccumulator Arabidopsis halleri.
    Plant J., 2004. 37(2): p. 251-68
    [PMID:14690509]
  4. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  5. Rajagopalan R,Vaucheret H,Trejo J,Bartel DP
    A diverse and evolutionarily fluid set of microRNAs in Arabidopsis thaliana.
    Genes Dev., 2006. 20(24): p. 3407-25
    [PMID:17182867]
  6. McCarthy RL,Zhong R,Ye ZH
    MYB83 is a direct target of SND1 and acts redundantly with MYB46 in the regulation of secondary cell wall biosynthesis in Arabidopsis.
    Plant Cell Physiol., 2009. 50(11): p. 1950-64
    [PMID:19808805]
  7. Winzell A,Aspeborg H,Wang Y,Ezcurra I
    Conserved CA-rich motifs in gene promoters of Pt x tMYB021-responsive secondary cell wall carbohydrate-active enzymes in Populus.
    Biochem. Biophys. Res. Commun., 2010. 394(3): p. 848-53
    [PMID:20307500]
  8. McCarthy RL, et al.
    The poplar MYB transcription factors, PtrMYB3 and PtrMYB20, are involved in the regulation of secondary wall biosynthesis.
    Plant Cell Physiol., 2010. 51(6): p. 1084-90
    [PMID:20427511]
  9. Zhong R, et al.
    Transcriptional activation of secondary wall biosynthesis by rice and maize NAC and MYB transcription factors.
    Plant Cell Physiol., 2011. 52(10): p. 1856-71
    [PMID:21908441]
  10. Zhong R,Ye ZH
    MYB46 and MYB83 bind to the SMRE sites and directly activate a suite of transcription factors and secondary wall biosynthetic genes.
    Plant Cell Physiol., 2012. 53(2): p. 368-80
    [PMID:22197883]
  11. Yan L, et al.
    The heterologous expression in Arabidopsis thaliana of sorghum transcription factor SbbHLH1 downregulates lignin synthesis.
    J. Exp. Bot., 2013. 64(10): p. 3021-32
    [PMID:23698629]
  12. Kim WC,Kim JY,Ko JH,Kim J,Han KH
    Transcription factor MYB46 is an obligate component of the transcriptional regulatory complex for functional expression of secondary wall-associated cellulose synthases in Arabidopsis thaliana.
    J. Plant Physiol., 2013. 170(15): p. 1374-8
    [PMID:23726771]