PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G07650.4
Common NameBBX7, COL9, MLP3.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family CO-like
Protein Properties Length: 372aa    MW: 40754.1 Da    PI: 6.2345
Description CONSTANS-like 9
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G07650.4genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box19.71.7e-06444539
     zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHkg......Htv 39
                 +C+ ++e++   +C+++  +lC +C  + H+       H++
  AT3G07650.4  4 MCDFCGEQRSMVYCRSDAACLCLSCDRSVHSAnalskrHSR 44
                 6*****************************65677777765 PP

2zf-B_box23.11.6e-074696439
     zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg...............Htv 39
                  +C++++ ++++  C + ++ lC++C  ++H++               H++
  AT3G07650.4 46 LVCERCNAQPATVRCVEERVSLCQNCDWSGHNNsnnnnssssstspqqHKR 96
                 68*****************************87666666666666666665 PP

3CCT60.46.1e-21315358144
          CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                  R++a++RYkeK+k RkF+K++rY+sRKa+A+ R RvKGrFvk+ 
  AT3G07650.4 315 RNNAVMRYKEKKKARKFDKRVRYASRKARADVRRRVKGRFVKAG 358
                  99***************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501199.798147IPR000315B-box-type zinc finger
CDDcd000219.11E-8447No hitNo description
SMARTSM003361.1E-8447IPR000315B-box-type zinc finger
PROSITE profilePS501198.8454387IPR000315B-box-type zinc finger
CDDcd000211.86E-54776No hitNo description
SMARTSM003364.84899IPR000315B-box-type zinc finger
PfamPF062031.0E-15315357IPR010402CCT domain
PROSITE profilePS5101715.338315357IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007623Biological Processcircadian rhythm
GO:0048579Biological Processnegative regulation of long-day photoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000014anatomyrosette leaf
PO:0000037anatomyshoot apex
PO:0000084anatomyplant sperm cell
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009001anatomyfruit
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001017developmental stageM germinated pollen stage
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 372 aa     Download sequence    Send to blast
MGYMCDFCGE QRSMVYCRSD AACLCLSCDR SVHSANALSK RHSRTLVCER CNAQPATVRC  60
VEERVSLCQN CDWSGHNNSN NNNSSSSSTS PQQHKRQTIS CYSGCPSSSE LASIWSFCLD  120
LAGQSICEQE LGMMNIDDDG PTDKKTCNED KKDVLVGSSS IPETSSVPQG KSSSAKDVGM  180
CEDDFYGNLG MDEVDMALEN YEELFGTAFN PSEELFGHGG IDSLFHKHQT APEGGNSVQP  240
AGSNDSFMSS KTEPIICFAS KPAHSNISFS GVTGESSAGD FQECGASSSI QLSGEPPWYP  300
PTLQDNNACS HSVTRNNAVM RYKEKKKARK FDKRVRYASR KARADVRRRV KGRFVKAGEA  360
YDYDPLTPTR SY
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.183370.0flower| root| seed| silique
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1453382360.0
Genevisible259244_at0.0
Expression AtlasAT3G07650-
AtGenExpressAT3G07650-
ATTED-IIAT3G07650-
Functional Description ? help Back to Top
Source Description
TAIRThis gene belongs to the CO (CONSTANS) gene family. This gene family is divided in three subgroups: groups III, to which COL9 belongs, is characterised by one B-box (supposed to regulate protein-protein interactions) and a second diverged zinc finger. COL9 downregulates expression of CO (CONSTANS) as well as FT and SOC1 which are known regulatory targets of CO.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G07650.4
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT1G65480(R), AT5G15840(R)
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G07650
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3169340.0AK316934.1 Arabidopsis thaliana AT3G07650 mRNA, complete cds, clone: RAFL14-22-K23.
GenBankBT0294900.0BT029490.1 Arabidopsis thaliana At3g07650 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001030659.10.0CONSTANS-like 9
RefseqNP_001118599.10.0CONSTANS-like 9
RefseqNP_187422.10.0CONSTANS-like 9
RefseqNP_974250.10.0CONSTANS-like 9
SwissprotQ9SSE50.0COL9_ARATH; Zinc finger protein CONSTANS-LIKE 9
TrEMBLA0A384KVH30.0A0A384KVH3_ARATH; COL9
TrEMBLA1A6H10.0A1A6H1_ARATH; AT3G07650 protein
STRINGAT3G07650.10.0(Arabidopsis thaliana)
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Robson F, et al.
    Functional importance of conserved domains in the flowering-time gene CONSTANS demonstrated by analysis of mutant alleles and transgenic plants.
    Plant J., 2001. 28(6): p. 619-31
    [PMID:11851908]
  3. Griffiths S,Dunford RP,Coupland G,Laurie DA
    The evolution of CONSTANS-like gene families in barley, rice, and Arabidopsis.
    Plant Physiol., 2003. 131(4): p. 1855-67
    [PMID:12692345]
  4. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  5. Kasukabe Y, et al.
    Overexpression of spermidine synthase enhances tolerance to multiple environmental stresses and up-regulates the expression of various stress-regulated genes in transgenic Arabidopsis thaliana.
    Plant Cell Physiol., 2004. 45(6): p. 712-22
    [PMID:15215506]
  6. Cheng XF,Wang ZY
    Overexpression of COL9, a CONSTANS-LIKE gene, delays flowering by reducing expression of CO and FT in Arabidopsis thaliana.
    Plant J., 2005. 43(5): p. 758-68
    [PMID:16115071]
  7. Lee J, et al.
    Analysis of transcription factor HY5 genomic binding sites revealed its hierarchical role in light regulation of development.
    Plant Cell, 2007. 19(3): p. 731-49
    [PMID:17337630]
  8. Li J,Webster M,Furuya M,Gilmartin PM
    Identification and characterization of pin and thrum alleles of two genes that co-segregate with the Primula S locus.
    Plant J., 2007. 51(1): p. 18-31
    [PMID:17561923]
  9. Fabro G, et al.
    Genome-wide expression profiling Arabidopsis at the stage of Golovinomyces cichoracearum haustorium formation.
    Plant Physiol., 2008. 146(3): p. 1421-39
    [PMID:18218973]
  10. Soitamo AJ,Piippo M,Allahverdiyeva Y,Battchikova N,Aro EM
    Light has a specific role in modulating Arabidopsis gene expression at low temperature.
    BMC Plant Biol., 2008. 8: p. 13
    [PMID:18230142]
  11. Khanna R, et al.
    The Arabidopsis B-box zinc finger family.
    Plant Cell, 2009. 21(11): p. 3416-20
    [PMID:19920209]
  12. Li G, et al.
    Coordinated transcriptional regulation underlying the circadian clock in Arabidopsis.
    Nat. Cell Biol., 2011. 13(5): p. 616-22
    [PMID:21499259]
  13. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]