PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G07500.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family FAR1
Protein Properties Length: 217aa    MW: 25314.8 Da    PI: 7.9697
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G07500.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR193.42.7e-2947136191
         FAR1   1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHelap 91 
                  +fY++YA+ +GF +r+++ ++s r+g++++r++vC+keg+r+++ ++ +++r++ra tr gCka ++vk+ek+g+w vtk+e+eHnH+l p
  AT3G07500.1  47 SFYDNYATCMGFVMRVDAFRRSMRDGTVVWRRLVCNKEGFRRSRPRR-SESRKPRAITREGCKALIVVKREKSGTWLVTKFEKEHNHPLLP 136
                  5********************************************99.9***************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031011.4E-2747136IPR004330FAR1 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009585Biological Processred, far-red light phototransduction
GO:0010018Biological Processfar-red light signaling pathway
GO:0042753Biological Processpositive regulation of circadian rhythm
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000293anatomyguard cell
Sequence ? help Back to Top
Protein Sequence    Length: 217 aa     Download sequence    Send to blast
MEGNSLPEED VEMMENSDVM KTVTDEASPM VEPFIGMEFE SEEAAKSFYD NYATCMGFVM  60
RVDAFRRSMR DGTVVWRRLV CNKEGFRRSR PRRSESRKPR AITREGCKAL IVVKREKSGT  120
WLVTKFEKEH NHPLLPLSPN VRRNFQLPQT PDEKDAKIRE LSAELSRERR RCTALQQQLD  180
MVLKEMEEHS NHLTININSV IQSVRDIESN TFTKQQT
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasAT3G07500
AtGenExpressAT3G07500
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G07500.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G07500
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0050830.0BT005083.1 Arabidopsis thaliana clone U20864 unknown protein (At3g07500) mRNA, complete cds.
GenBankBT0040310.0BT004031.1 Arabidopsis thaliana clone RAFL15-31-E07 (R20864) unknown protein (At3g07500) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_187406.21e-162far-red impaired responsive 1-like protein
TrEMBLQ84JA71e-162Q84JA7_ARATH; Far-red impaired responsive 1-like protein
STRINGAT3G07500.11e-161(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3376727
MalvidsOGEM135242227
Publications ? help Back to Top
  1. Hanada K, et al.
    Functional compensation of primary and secondary metabolites by duplicate genes in Arabidopsis thaliana.
    Mol. Biol. Evol., 2011. 28(1): p. 377-82
    [PMID:20736450]
  2. Arabidopsis Interactome Mapping Consortium
    Evidence for network evolution in an Arabidopsis interactome map.
    Science, 2011. 333(6042): p. 601-7
    [PMID:21798944]