PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G05860.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family M-type_MADS
Protein Properties Length: 260aa    MW: 30416.4 Da    PI: 7.729
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G05860.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF542.2e-171150342
                 --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
       SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
                 i n+s r+ tf kR++g+ KK +ELSvLC++e++ +i+s+
  AT3G05860.1 11 ITNESMRKATFNKRKKGLVKKIHELSVLCGIEACAVIYSP 50
                 89*************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006617.703149IPR002100Transcription factor, MADS-box
SMARTSM004323.4E-24160IPR002100Transcription factor, MADS-box
CDDcd002667.51E-34285No hitNo description
SuperFamilySSF554554.58E-24294IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-10323IPR002100Transcription factor, MADS-box
PfamPF003191.9E-171151IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-102338IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-103859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009009anatomyplant embryo
PO:0009089anatomyendosperm
Sequence ? help Back to Top
Protein Sequence    Length: 260 aa     Download sequence    Send to blast
MTRKKLNLSY ITNESMRKAT FNKRKKGLVK KIHELSVLCG IEACAVIYSP FNSNPEVWPS  60
NSEVKNVMEN FEMLTKLEQE KKMVSHEGFI RQNISKTMES NNKKMIDNAE RTMKEAMFQL  120
LSGKGEKLNL TDRNREDLCK YIDQYLKELY HHKNKTINQS HIEPGESSGA TNAMTPTSVV  180
EPIISSIQRP NQNPNFNHLS HNQYQYQQQF GYPILVQDGI YNPSQIQNQH EEWLDDHMMN  240
HSKEISHPLM DDNNFYYQQP
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible258734_at0.0
Expression AtlasAT3G05860-
AtGenExpressAT3G05860-
ATTED-IIAT3G05860-
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G05860.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
BioGRIDAT4G36590
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G05860
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY1412510.0AY141251.1 Arabidopsis thaliana MADS-box protein AGL45-I mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_187237.20.0MADS-box transcription factor family protein
TrEMBLF4J9K30.0F4J9K3_ARATH; MADS-box transcription factor family protein
STRINGAT3G05860.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7028415
Representative plantOGRP11413173
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. De Bodt S, et al.
    Genomewide structural annotation and evolutionary analysis of the type I MADS-box genes in plants.
    J. Mol. Evol., 2003. 56(5): p. 573-86
    [PMID:12698294]
  3. Parenicov√° L, et al.
    Molecular and phylogenetic analyses of the complete MADS-box transcription factor family in Arabidopsis: new openings to the MADS world.
    Plant Cell, 2003. 15(7): p. 1538-51
    [PMID:12837945]
  4. Kofuji R, et al.
    Evolution and divergence of the MADS-box gene family based on genome-wide expression analyses.
    Mol. Biol. Evol., 2003. 20(12): p. 1963-77
    [PMID:12949148]
  5. de Folter S, et al.
    Comprehensive interaction map of the Arabidopsis MADS Box transcription factors.
    Plant Cell, 2005. 17(5): p. 1424-33
    [PMID:15805477]
  6. Day RC,Herridge RP,Ambrose BA,Macknight RC
    Transcriptome analysis of proliferating Arabidopsis endosperm reveals biological implications for the control of syncytial division, cytokinin signaling, and gene expression regulation.
    Plant Physiol., 2008. 148(4): p. 1964-84
    [PMID:18923020]
  7. Bemer M,Heijmans K,Airoldi C,Davies B,Angenent GC
    An atlas of type I MADS box gene expression during female gametophyte and seed development in Arabidopsis.
    Plant Physiol., 2010. 154(1): p. 287-300
    [PMID:20631316]